Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/13159
Proper Citation: RRID:Addgene_13159
Insert Name: ZF109
Bacterial Resistance: Ampicillin
Defining Citation: PMID:17406455
Vector Backbone Description: Backbone Marker:Modified Invitrogen pcDNA3; Backbone Size:5400; Vector Backbone:pc3XB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Part of the Zinc Finger Consortium Modular Assembly Kit v1.0. Finger protein sequence: PGEKPFMCTWSYCGKRFTDRSALARHKRTH. Target DNA sequence: GTC. This zinc finger is derived from the ToolGen module set. ToolGen ZF ID: 5. ToolGen ZF Name: dsar.
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
Check
for all resource mentions.
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for pc3XB-ZF109.
No alerts have been found for pc3XB-ZF109.
Source: Addgene
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
