Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/114828
Proper Citation: RRID:Addgene_114828
Insert Name: AT1G78980
Organism: Arabidopsis thaliana
Bacterial Resistance: Ampicillin
Defining Citation: PMID:29320478
Vector Backbone Description: Backbone Marker:Chris Garcia (Addgene plasmid # 47051); Vector Backbone:pECIA14; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Comments: Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags. Insert Protein Sequence: KTDNQEVSALNVMFTSLNSPSKLKGWKANGGDPCEDSWEGVKCKGSSVTELQLSGFELGGSRGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSENELDGNVPYSLSQMKNLQSINLGQNKLNGELPDMFQKLSKLETLDFSLNKLSGKLPQSFANLTSLKKLHLQDNRFTGDINVLRNLAIDDLNVEDNQFEGWIPNELKDIDSLLTGGNDWSTETAPPPPPGVKYGRKSSGSKDG
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for SRF5 B3_pECIA14 .
No alerts have been found for SRF5 B3_pECIA14 .
Source: Addgene (RRID:SCR_002037)
Description: Non-profit plasmid repository dedicated to helping scientists around the world share high-quality plasmids. Facilitates archiving and distributing DNA-based research reagents and associated data to scientists worldwide. Repository contains over 65,000 plasmids, including special collections on CRISPR, fluorescent proteins, and ready-to-use viral preparations. There is no cost for scientists to deposit plasmids, which saves time and money associated with shipping plasmids themselves. All plasmids are fully sequenced for validation and sequencing data is openly available. We handle the appropriate Material Transfer Agreements (MTA) with institutions, facilitating open exchange and offering intellectual property and liability protection for depositing scientists. Furthermore, we curate free educational resources for the scientific community including a blog, eBooks, video protocols, and detailed molecular biology resources.
URL: http://www.addgene.org