Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: single chain-Fv, scFv
Vector Backbone Description: Backbone Marker:DDD, Science for Life Laboratory; Vector Backbone:pHAT6; Vector Types:Bacterial Expression, Recombinant Antibody Expression; Bacterial Resistance:Kanamycin
Comments: Target NCBI gene ID: 6597
Proper citation: RRID:Addgene_166519 Copy
Vector Backbone Description: Backbone Size:7179; Vector Types:Worm Expression; Bacterial Resistance:Ampicillin
Comments: See Fire Lab Vector Kit Documentation 1999. Fire Lab Miniprep Number pPD133.51, Ligation number L4664.
Proper citation: RRID:Addgene_1666 Copy
Species: Homo sapiens
Genetic Insert: GGamma5-GFP2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5432; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32367019
Comments: These plasmids were generated as part of the Illuminating the Druggable Genome (IDG) program sponsored by the NIH Common Fund. The goal of this program is to identify, gather, and distribute information and resources for proteins that currently are not well-studied yet belong to commonly drug-targeted protein families: protein kinases, non-olfactory G-protein coupled receptors (GPCRs), and ion channels. The IDG program is designed to develop fundamental research tools for understudied proteins, elucidate their function, and disseminate the IDG-related resources and data to the greater scientific community.
Proper citation: RRID:Addgene_166777 Copy
Species: Homo sapiens
Genetic Insert: GGamma10-GFP2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5432; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32367019
Comments: These plasmids were generated as part of the Illuminating the Druggable Genome (IDG) program sponsored by the NIH Common Fund. The goal of this program is to identify, gather, and distribute information and resources for proteins that currently are not well-studied yet belong to commonly drug-targeted protein families: protein kinases, non-olfactory G-protein coupled receptors (GPCRs), and ion channels. The IDG program is designed to develop fundamental research tools for understudied proteins, elucidate their function, and disseminate the IDG-related resources and data to the greater scientific community.
Proper citation: RRID:Addgene_166779 Copy
Species: Synthetic
Genetic Insert: ActA tail anchor (Listeria monocytogenes)
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "SGLRSRGSGLRSRAQASNSAVDARGSGLRSRAQASNSAVDARGSGLRSRAQASNSAVDAR
GSGLRSRAQASNSAVDARV" amino acid targeting sequence, which we refer to as "ActA", for the mitochondrial outer membrane. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "79aa" indicates the 79 amino acid flexible linker region between Venus and the ActA targeting signal.
Proper citation: RRID:Addgene_166763 Copy
Species: Homo sapiens
Genetic Insert: Noxa
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: Venus fused to the N-terminus of human Noxa amino acid sequence: "MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT". Linked by a 30 amino acid (aa) linker.
Proper citation: RRID:Addgene_166762 Copy
Species: Homo sapiens
Genetic Insert: BimEL(Mus musculus)-(Noxa BH3)
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:35442739
Comments: BH3 region removed and inserted BH3 of Noxa protein. There is a K107E mutation in the Venus sequence of this plasmid. The K107E mutation is facing outwards in the B-Barrel structure of the Venus protein. Therefore, it is unlikely that this mutation would affect the chromophore within the β-barrel. We have transfected this plasmid in BMK-DKO cells and did not observe aggregation. We also used this construct and observed Forster resonance energy transfer from mCerulean3 in the context of measuring interactions with two binding partners. Thus, this mutation does not appear to affect the Venus fluorophore.
Proper citation: RRID:Addgene_166761 Copy
Species: Homo sapiens
Genetic Insert: MAO tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C3; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "WERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS" amino acid targeting sequence, which we refer to as "MAO", for mitochondrial outer membrane targeting. Pearson's correlation of 0.8-0.9 with mitotracker red signal in cells. "7aa" indicates the 7 amino acid flexible linker region between Venus and the ActA targeting signal for mitochondria.
Proper citation: RRID:Addgene_166765 Copy
Species: Rattus norvegicus
Genetic Insert: Cb5 tail anchor
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Comments: "KITTVESNSSWWTNWVIPAISALVVALMYRLYMAED" amino acid targeting sequence, which we refer to as "Cb5", for endoplasmic reticulum targeting. "7aa" indicates the 7 amino acid flexible linker region between Venus and the Cb5 targeting signal.
Proper citation: RRID:Addgene_166764 Copy
Species: Homo sapiens
Genetic Insert: Angiomotin p130 L129A P130A
Vector Backbone Description: Backbone Size:5446; Vector Backbone:pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34284061
Proper citation: RRID:Addgene_166711 Copy
Species: Homo sapiens
Genetic Insert: NEDD4L W576A
Vector Backbone Description: Backbone Size:5842; Vector Backbone:pCI-FLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34284061
Proper citation: RRID:Addgene_166710 Copy
Species: Homo sapiens
Genetic Insert: AAVR-FLAG
Vector Backbone Description: Backbone Marker:addgene plasmid #17452; Backbone Size:9628; Vector Backbone:pLenti-CMV-Puro-DEST; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26814968
Proper citation: RRID:Addgene_166716 Copy
Species: Homo sapiens
Genetic Insert: Angiomotin p130 L106P
Vector Backbone Description: Backbone Size:5446; Vector Backbone:pcDNA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34284061
Proper citation: RRID:Addgene_166714 Copy
Species: Lachnospiraceae bacterium C6A11
Genetic Insert: LahT150
Vector Backbone Description: Backbone Marker:Addgene; Backbone Size:5420; Vector Backbone:pETDuet; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30638446
Proper citation: RRID:Addgene_166785 Copy
Genetic Insert: Spike receptor binding domain (RBD) from SARS-CoV-2
Vector Backbone Description: Backbone Marker:Andrew Scharenberg; Vector Backbone:pETcon(-) (Plasmid #41522); Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32841599
Proper citation: RRID:Addgene_166782 Copy
Species: Homo sapiens
Genetic Insert: DPP9
Vector Backbone Description: Vector Backbone:pFastBac HTB; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33731932
Comments: Insect cell expression vector for DPP9S (protein purification)
Proper citation: RRID:Addgene_166787 Copy
Species: Homo sapiens
Genetic Insert: GGamma12-GFP2
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5432; Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:32367019
Comments: These plasmids were generated as part of the Illuminating the Druggable Genome (IDG) program sponsored by the NIH Common Fund. The goal of this program is to identify, gather, and distribute information and resources for proteins that currently are not well-studied yet belong to commonly drug-targeted protein families: protein kinases, non-olfactory G-protein coupled receptors (GPCRs), and ion channels. The IDG program is designed to develop fundamental research tools for understudied proteins, elucidate their function, and disseminate the IDG-related resources and data to the greater scientific community.
Proper citation: RRID:Addgene_166781 Copy
Species: Homo sapiens
Genetic Insert: AMOT PPxY1 fused to NEDD4L WW3
Vector Backbone Description: Backbone Size:5597; Vector Backbone:pCA528; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34284061
Proper citation: RRID:Addgene_166705 Copy
Species: Homo sapiens
Genetic Insert: NEDD4L WW2 domain
Vector Backbone Description: Backbone Size:5797; Vector Backbone:pGEX-PP-GFP; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34284061
Proper citation: RRID:Addgene_166702 Copy
Species: Homo sapiens
Genetic Insert: NEDD4L W221A
Vector Backbone Description: Backbone Size:5842; Vector Backbone:pCI-FLAG; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34284061
Proper citation: RRID:Addgene_166707 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.