Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: SARS-CoV-2
Genetic Insert: 3xFlag-His-nsp5CS-nsp9
Vector Backbone Description: Vector Backbone:pLIB (biGBac); Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:34198327
Comments: Baculovirus generation using Tn7 transposition (Bac-to-Bac).
Proper citation: RRID:Addgene_169177 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 Nsp3 Mac1
Vector Backbone Description: Backbone Size:5358; Vector Backbone:pET22b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33853786
Proper citation: RRID:Addgene_169209 Copy
Species: SARS-CoV-2
Genetic Insert: 14His-SUMO-nsp7
Vector Backbone Description: Vector Backbone:pK27Sumo; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:34198323
Proper citation: RRID:Addgene_169186 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 RBD
Vector Backbone Description: Backbone Marker:Eric Kowarz; Backbone Size:6625; Vector Backbone:pSBbi-RP (Addgene Plasmid #60513); Vector Types:Mammalian Expression, Transposon; Bacterial Resistance:Ampicillin
Defining Citation: PMID:36619904
Comments: The SARS-CoV-2 RBD insert was designed by Jorge L. Arias-Arias from Universidad de Costa Rica ([email protected]).
This vector is suitable for transient transfection, but it was intended to be co-transfected with the transposase vector pCMV(CAT)T7-SB100 (Addgene Plasmid #34879) in order to generate stable mammalian cells for the production of SARS-CoV-2 RBD protein. This protein can be recovered from the cell culture medium by His-tag purification.
The recombinant RBD is suitable for COVID-19 serology testing and monitoring of humoral responses in vaccinated population.
Proper citation: RRID:Addgene_161793 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF6
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)FHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID - UniProtKB - P0DTC6 (NS6_SARS2)
Proper citation: RRID:Addgene_162817 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_9b
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Protein sequence: (TAG)DPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK - UniProtKB - P0DTD2 (ORF9B_SARS2)
Proper citation: RRID:Addgene_162816 Copy
Species: SARS-CoV-2
Genetic Insert: Ub-(N-TAG)CoV2_ORF3b_alt
Vector Backbone Description: Vector Backbone:pAS; Vector Types:Mammalian Expression, PiggyBac; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33175524
Comments: Alternative ORF3b as described in Hachim et. al., 2020, (doi:10.1038/s41590-020-0773-7) - Protein sequence: (TAG)AYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP
Proper citation: RRID:Addgene_162821 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 Spike
Vector Backbone Description: Backbone Marker:Vectorbuilder; Vector Backbone:pRP; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Comments: Codon-optimized SARS-CoV-2 Spike was cloned from SinoBiological plasmid VG40589-UT. An 18-amino acid truncation was introduced to improve expression. The plasmid can be used to generate Spike-pseudotyped lentiviral or VSV particles.
Proper citation: RRID:Addgene_164583 Copy
Species: SARS-COV-2
Genetic Insert: Nsp3
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:4700; Vector Backbone:pEGFPN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33666950
Comments: Please visit https://www.biorxiv.org/content/10.1101/2020.12.19.423586v1 for BioRxiv preprint. bioRxiv 2020.12.19.423586v1
Proper citation: RRID:Addgene_165108 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 S protein
Vector Backbone Description: Vector Backbone:pCAGGS; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33243994
Comments: Pseudotypes to the MLV vector but not efficiently to VSV or lentiviral vectors.
Please visit https://www.biorxiv.org/content/10.1101/2020.06.12.148726v1 for bioRxiv preprint.
Proper citation: RRID:Addgene_159363 Copy
Species: SARS-CoV-2
Genetic Insert: 3CL Protease
Vector Backbone Description: Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33910954
Comments: This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta.
The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed.
Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint.
Proper citation: RRID:Addgene_160278 Copy
Species: SARS-CoV-2
Genetic Insert: 3CL Protease
Vector Backbone Description: Vector Backbone:pLEX_307; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33910954
Comments: This plasmid is stored and distributed in NEB Stable. It can also be used to transform NEB 10Beta.
The authors have noticed that there are high rates of recombination in these generated vectors. All users are advised to sequence the vectors and run them on a gel to ensure they show the expected full length insert and plasmid size. In cases where recombination has occurred it is typically between the viral LTR elements in the vector although recombination between the gateway cloning sites has also been observed.
Please visit https://doi.org/10.1101/2020.08.29.272864 for bioRxiv preprint.
Proper citation: RRID:Addgene_160279 Copy
Species: SARS-CoV-2
Genetic Insert: SARS-CoV-2 Receptor Binding domain
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:5442; Vector Backbone:pET21b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33532775
Proper citation: RRID:Addgene_167126 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1584-1945)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167261 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 1089-1203)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167260 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp15 (residues 1-346)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167265 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp9 (residues 1-113)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167264 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp3 (residues 413-676)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167258 Copy
Species: SARS-CoV-2
Genetic Insert: Nsp1 (residues 13-127)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:33319167
Proper citation: RRID:Addgene_167256 Copy
Species: SARS-CoV-2
Genetic Insert: N protein (residues 1-419)
Vector Backbone Description: Vector Backbone:pMCSG53; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_167255 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
