Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
AtCOPT1 upGFP Resource Report Resource Website |
RRID:Addgene_117899 | AtCOPT1 upGFP | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:12 | 0 | ||
|
AtCOPT1 uPIC Resource Report Resource Website |
RRID:Addgene_117898 | AtCOPT1 uPIC | Arabidopsis thaliana | Bleocin (Zeocin) | insert amino acid sequence: MDHDHMHGMPRPSSSSSSSPSSMMNNGSMNEGGGHHHMKMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIFVFFLAVLTEWLAHSSLLRGSTGDSANRAAGLIQTAVYTLRIGLAYLVMLAVMSFNAGVFLVALAGHAVGFMLFGSQTFRNTSDDRKTNYVPPSGCACENLYQSHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:12 | 0 | ||
|
OsSLAC1 Resource Report Resource Website |
RRID:Addgene_117904 | OsSLAC1 | Oryza sativa | Bleocin (Zeocin) | insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTENLYFQSGSHHHHHHHHHH | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:12 | 0 | ||
|
p221z-CAS9p-TagRFP-t35s Resource Report Resource Website 1+ mentions |
RRID:Addgene_118386 | CAS9p-TagRFP | Other | Bleocin (Zeocin) | PMID:32601420 | Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:15 | 1 | ||
|
p221z-CAS9p-t35s Resource Report Resource Website |
RRID:Addgene_118385 | CAS9p | Other | Bleocin (Zeocin) | PMID:32601420 | Vector Backbone:pDONR-221z; Vector Types:CRISPR; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:15 | 0 | ||
|
DH10B-M.XmnI Resource Report Resource Website |
RRID:Addgene_114269 | Bleocin (Zeocin) | PMID:29986052 | See Supplemental Documents for strain verification protocols and data. | Vector Backbone:None; Vector Types:; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:35:37 | 0 | |||
|
DH10B-M2.NmeMC58II Resource Report Resource Website |
RRID:Addgene_114268 | Bleocin (Zeocin) | PMID:29986052 | See Supplemental Documents for strain verification protocols and data. | Vector Backbone:None; Vector Types:; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:35:37 | 0 | |||
|
MP28444 – pFUSE2ss-aRD114_CHIg-mIgG2A Resource Report Resource Website |
RRID:Addgene_110555 | Anti-RD114 heavy chain | RD114 retrovirus | Bleocin (Zeocin) | PMID:31702531 | Backbone Marker:Invivogen; Backbone Size:3431; Vector Backbone:pFUSEss; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:35:00 | 0 | ||
|
pBADZ-HisCre Resource Report Resource Website 1+ mentions |
RRID:Addgene_111187 | Cre recombinase | Bleocin (Zeocin) | PMID:15568020 | The protocol for preparation of electro-competent cells of DH10MultiBacCre,which carry the plasmid of pBADZ HisCre and enable the production of Cre recombinase, is described in Fitzgerald et al. (2006). http://www.nature.com/articles/nmeth983 | Vector Backbone:pBAD22; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:35:06 | 1 | ||
|
AtPIN1 Resource Report Resource Website |
RRID:Addgene_117088 | AtPIN1 | Arabidopsis thaliana | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
AtPIN2 Resource Report Resource Website |
RRID:Addgene_117089 | AtPIN2 | Arabidopsis thaliana | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
MtPT4-eGFP Resource Report Resource Website |
RRID:Addgene_117095 | MtPT4-eGFP | Other | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
MtPT4 Resource Report Resource Website |
RRID:Addgene_117096 | MtPT4 | Other | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
AtNPY1 Resource Report Resource Website |
RRID:Addgene_117090 | AtNPY1 | Arabidopsis thaliana | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
SLAC-deltaCdeltaN Resource Report Resource Website |
RRID:Addgene_117103 | SLAC-deltaCdeltaN | Arabidopsis thaliana | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
SLAC-deltaC Resource Report Resource Website |
RRID:Addgene_117102 | SLAC-deltaC | Arabidopsis thaliana | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
SLAH3 Resource Report Resource Website |
RRID:Addgene_117105 | SLAH3 | Arabidopsis thaliana | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
SLAC1-FL Resource Report Resource Website |
RRID:Addgene_117100 | SLAC1-FL | Arabidopsis thaliana | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
MCA2-eGFP Resource Report Resource Website |
RRID:Addgene_117098 | MCA2-eGFP | Arabidopsis thaliana | Bleocin (Zeocin) | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2026-07-25 12:36:05 | 0 | |||
|
pPICZ-pOst1-pro-alphaf(MUT2)-E2-Crimson Resource Report Resource Website |
RRID:Addgene_117663 | pOst1-pro-af(MUT2)-E2-Crimson | Other | Bleocin (Zeocin) | PMID:30314480 | Integration plasmid in the pAOX1 locus. | Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | This plasmid encodes the fluorescent protein E2-Crimson together with an hibrid secretion signal. This secretion signal is composed by the the signal sequence of Ost1 from Saccharomyces cerevisiae and the the native mating alpha factor pro region from Saccharomyces cerevisiae. The pro region has Glu at position 83. | 2026-07-25 12:36:09 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
