SYSTEM UPDATE: We will be performing system maintenace Saturday September 26 at 9pm to midnight Pacific Time

Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

On page 258 showing 5141 ~ 5160 out of 742,877 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to a Collection
  • RRID:Addgene_104167

http://www.addgene.org/104167

Species: Vicugna pacos
Genetic Insert: Anti-GFP nanobody Enhancer PDB 3K1K (3x Cysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26633879

Proper citation: RRID:Addgene_104167 Copy   


  • RRID:Addgene_104200

http://www.addgene.org/104200

Species: Homo sapiens
Genetic Insert: human androgen receptor aa 624-919
Vector Backbone Description: Backbone Marker:Pharmacia; Backbone Size:4900; Vector Backbone:pGEX-5x-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:12612084

Proper citation: RRID:Addgene_104200 Copy   


  • RRID:Addgene_104166

http://www.addgene.org/104166

Species: Vicugna pacos
Genetic Insert: Anti-GFP nanobody Enhancer PDB 3K1K (1x Cysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:26633879

Proper citation: RRID:Addgene_104166 Copy   


  • RRID:Addgene_104201

http://www.addgene.org/104201

Species: Homo sapiens
Genetic Insert: human androgen receptor aa 400-449
Vector Backbone Description: Backbone Marker:Pharmacia; Vector Backbone:pGEX-4T-1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin

Proper citation: RRID:Addgene_104201 Copy   


  • RRID:Addgene_104163

    This resource has 1+ mentions.

http://www.addgene.org/104163

Species: Vicugna pacos
Genetic Insert: Anti-rabbit IgG Fc specific nanobody TP897 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082

Proper citation: RRID:Addgene_104163 Copy   


  • RRID:Addgene_104162

    This resource has 1+ mentions.

http://www.addgene.org/104162

Species: Vicugna pacos
Genetic Insert: Anti-mouse kappa chain specific nanobody TP1170 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082

Proper citation: RRID:Addgene_104162 Copy   


http://www.addgene.org/104204

Species: Homo sapiens
Genetic Insert: NEDD4L WW domain #1
Vector Backbone Description: Vector Backbone:pHH0103; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Comments: Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - PPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDV

Proper citation: RRID:Addgene_104204 Copy   


http://www.addgene.org/104181

Species: Arabidopsis thaliana
Genetic Insert: CRY2(neutral2-6)-mCherry
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pmCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28916751

Proper citation: RRID:Addgene_104181 Copy   


  • RRID:Addgene_104183

    This resource has 1+ mentions.

http://www.addgene.org/104183

Genetic Insert: U6-CUGsgRNA, EFS-PIN-dCas9
Vector Backbone Description: Vector Backbone:LentiCRISPR v2; Vector Types:Lentiviral, CRISPR; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28803727

Proper citation: RRID:Addgene_104183 Copy   


  • RRID:Addgene_104061

    This resource has 10+ mentions.

http://www.addgene.org/104061

Genetic Insert: GFP
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30626963
Comments: Please visit https://www.biorxiv.org/content/early/2018/01/19/246405 for bioRxiv preprint.

Proper citation: RRID:Addgene_104061 Copy   


  • RRID:Addgene_104057

http://www.addgene.org/104057

Genetic Insert: EYFP-f
Vector Backbone Description: Backbone Size:4745; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30626963
Comments: Please visit https://www.biorxiv.org/content/early/2018/01/19/246405 for bioRxiv preprint.

Proper citation: RRID:Addgene_104057 Copy   


http://www.addgene.org/104176

Species: Homo sapiens
Genetic Insert: CRY2low-tdTomato-Raf1
Vector Backbone Description: Backbone Size:4000; Vector Backbone:pmCherryN1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:28916751

Proper citation: RRID:Addgene_104176 Copy   


  • RRID:Addgene_104054

    This resource has 1+ mentions.

http://www.addgene.org/104054

Genetic Insert: 2xNLS-tdTomato
Vector Backbone Description: Backbone Size:6023; Vector Backbone:pAAV; Vector Types:AAV; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30626963
Comments: Please visit https://www.biorxiv.org/content/early/2018/01/19/246405 for bioRxiv preprint.

Proper citation: RRID:Addgene_104054 Copy   


  • RRID:Addgene_104145

http://www.addgene.org/104145

Vector Backbone Description: Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33095053

Proper citation: RRID:Addgene_104145 Copy   


  • RRID:Addgene_104144

http://www.addgene.org/104144

Vector Backbone Description: Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33095053

Proper citation: RRID:Addgene_104144 Copy   


  • RRID:Addgene_104147

http://www.addgene.org/104147

Vector Backbone Description: Backbone Size:9550; Vector Backbone:p15A; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Chloramphenicol
Defining Citation: PMID:33095053

Proper citation: RRID:Addgene_104147 Copy   


http://www.addgene.org/104140

Species: Renilla reniformis
Genetic Insert: Renilla luciferase
Vector Backbone Description: Vector Backbone:pSF4; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29056324

Proper citation: RRID:Addgene_104140 Copy   


  • RRID:Addgene_104143

http://www.addgene.org/104143

Vector Backbone Description: Backbone Size:3100; Vector Backbone:pSC101; Vector Types:Bacterial Expression, CRISPR; Bacterial Resistance:Kanamycin
Defining Citation: PMID:33095053

Proper citation: RRID:Addgene_104143 Copy   


http://www.addgene.org/104156

Species: Homo sapiens
Genetic Insert: ARHGAP29 promoter
Vector Backbone Description: Vector Backbone:pGL3 basic; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:28538170

Proper citation: RRID:Addgene_104156 Copy   


  • RRID:Addgene_104158

    This resource has 1+ mentions.

http://www.addgene.org/104158

Species: Vicugna pacos
Genetic Insert: Anti-mouse IgG1 Fc specific nanobody TP1107 (1xCysteine)
Vector Backbone Description: Vector Backbone:pQE80 derivative; Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:29263082

Proper citation: RRID:Addgene_104158 Copy   



Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X