Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: tristetraprolin
Vector Backbone Description: Backbone Marker:Thermo Scientific; Vector Backbone:pTRIPZ; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29246442
Comments: Please note- Addgene's quality control found one “g” nucleotide missing from the insert sequence. The depositor noted this "g" should make no difference to the function of plasmid, since it is located within an intron and will be spliced out.
Proper citation: RRID:Addgene_107000 Copy
Species: Synthetic
Genetic Insert: colEdes13/Imdes13
Vector Backbone Description: Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30538236
Comments: Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes13: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSKQFKRSNQNNIKQGIAPFARSKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes13: MELKHSISDYTEAEFLEFVKKIMASNDETQQRKLVTEFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Proper citation: RRID:Addgene_107121 Copy
Species: Homo sapiens
Genetic Insert: CD274
Vector Backbone Description: Backbone Marker:Promega; Vector Backbone:pGL3; Vector Types:Mammalian Expression, Luciferase; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29246442
Proper citation: RRID:Addgene_107009 Copy
Species: Synthetic
Genetic Insert: M. sedula PCNA1
Vector Backbone Description: Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107063 Copy
Species: Ogataea parapolymorpha
Genetic Insert: HH-gRNA-HDV targetting OpKU80 inO. parapolymorpha
Vector Backbone Description: Backbone Marker:Juergens H et al. Genome editing in Kluyveromyces and Ogataea yeasts using a broad-host-range Cas9/gRNA expression plasmid; Backbone Size:10046; Vector Backbone:pUDP002 #103872; Vector Types:Yeast Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29438517
Proper citation: RRID:Addgene_107062 Copy
Species: Synthetic
Genetic Insert: YC3.6
Vector Backbone Description: Vector Backbone:pGreenII 0179; Vector Types:Plant Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:18284694
Proper citation: RRID:Addgene_107061 Copy
Species: Mus musculus
Genetic Insert: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Vector Backbone Description: Vector Backbone:pRRL; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29323272
Proper citation: RRID:Addgene_107057 Copy
Vector Backbone Description: Vector Backbone:pAAV; Vector Types:Mammalian Expression, AAV, CRISPR; Bacterial Resistance:Ampicillin
Proper citation: RRID:Addgene_107055 Copy
Species: Synthetic
Genetic Insert: M. sedula PCNA3
Vector Backbone Description: Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107075 Copy
Species: Synthetic
Genetic Insert: M. sedula PCNA2
Vector Backbone Description: Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107074 Copy
Species: Synthetic
Genetic Insert: M. sedula PCNA1
Vector Backbone Description: Backbone Marker:Takara Bio; Backbone Size:2700; Vector Backbone:pMD20; Vector Types:Cloning vector; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107073 Copy
Species: Synthetic
Genetic Insert: YPet-CyPet fusion protein
Vector Backbone Description: Backbone Marker:Merck Millipore; Backbone Size:5700; Vector Backbone:pET-15b; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107072 Copy
Species: Synthetic
Genetic Insert: DNA ligase 1
Vector Backbone Description: Backbone Marker:Merck Millipore; Backbone Size:5400; Vector Backbone:pET-28b(+); Vector Types:Bacterial Expression; Bacterial Resistance:Kanamycin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107071 Copy
Species: Homo sapiens
Genetic Insert: RAB35
Vector Backbone Description: Backbone Marker:Sabatini lab; Vector Backbone:pLJM60; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26338797
Proper citation: RRID:Addgene_107106 Copy
Species: Homo sapiens
Genetic Insert: RAB35
Vector Backbone Description: Backbone Marker:Sabatini lab; Vector Backbone:pLJM60; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:26338797
Proper citation: RRID:Addgene_107105 Copy
Species: Synthetic
Genetic Insert: S. solfataricus PCNA3
Vector Backbone Description: Backbone Marker:New England Biolabs; Backbone Size:5670; Vector Backbone:pMAL-c5E; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:27228945
Proper citation: RRID:Addgene_107069 Copy
Species: Synthetic
Genetic Insert: colEdes2/Imdes2
Vector Backbone Description: Backbone Size:5440; Vector Backbone:pET21d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:30538236
Comments: Two genes in tandem (colE, Im), separated by 2 nucleotides (AA). See partial sequences. AA sequence of colEdes2: MESKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWKEVAKDPDLAKQFKRANRRNIKQGRAPFAPKKDQVGGRRTFELHHDKPISQDGGVYDMNNIRVTTPKRHIDIHRGK and AA sequence of Imdes2: MELKHSISDYTEAEFLEFVKKIYNSTDEEKQKELVTEFERLTEHPSGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQGLEHHHHHH
Proper citation: RRID:Addgene_107109 Copy
Species: Synthetic
Genetic Insert: F37A+L196F+V252A+C253G-hADPRM GST-mutant cADPR phosphohydrolase gene
Vector Backbone Description: Backbone Marker:GE Healthcare; Backbone Size:4946; Vector Backbone:pGEX-6P-3; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
Defining Citation: PMID:29348648
Proper citation: RRID:Addgene_107163 Copy
Vector Backbone Description: Backbone Marker:Khang et al, 2010 http://www.plantcell.org/content/22/4/1388; Backbone Size:9617; Vector Backbone:pBHt2G; Vector Types:Fungal grobacterium transformation plasmid, tested in Magnaporthe; Bacterial Resistance:Ampicillin
Comments: Golden-Gate compatible Magnaporthe oryzae Agrobacterium transformation vectors. Pennington HG, Youles M, Kamoun S. Figshare (2018) 10.6084/m9.figshare.5808348
Proper citation: RRID:Addgene_107162 Copy
Species: Homo sapiens
Genetic Insert: Flag-hPKL S113D
Vector Backbone Description: Backbone Marker:Clontech; Backbone Size:6819; Vector Backbone:pLHCX; Vector Types:Mammalian Expression, Retroviral; Bacterial Resistance:Ampicillin
Defining Citation: PMID:31825824
Proper citation: RRID:Addgene_107161 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.