Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856789
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SFXN1
Proper citation: Atlas Antibodies Cat# HPA019543, RRID:AB_1856789 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851791
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEE; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): INHBA
Proper citation: Atlas Antibodies Cat# HPA020031, RRID:AB_1851791 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854243
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MYL2
Proper citation: Atlas Antibodies Cat# HPA019763, RRID:AB_1854243 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858231
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRAF6
Proper citation: Atlas Antibodies Cat# HPA019805, RRID:AB_1858231 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669651
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): AMACR
Proper citation: Atlas Antibodies Cat# HPA019527, RRID:AB_10669651 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855601
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PPA1
Proper citation: Atlas Antibodies Cat# HPA019878, RRID:AB_1855601 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847988
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LPAR2
Proper citation: Atlas Antibodies Cat# HPA019616, RRID:AB_1847988 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2670231
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): FNBP1
Proper citation: Atlas Antibodies Cat# HPA019691, RRID:AB_2670231 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844444
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ABCG8
Proper citation: Atlas Antibodies Cat# HPA019556, RRID:AB_1844444 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844439
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ABCF2
Proper citation: Atlas Antibodies Cat# HPA020091, RRID:AB_1844439 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847400
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PPID
Proper citation: Atlas Antibodies Cat# HPA019520, RRID:AB_1847400 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847210
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CRAT
Proper citation: Atlas Antibodies Cat# HPA020260, RRID:AB_1847210 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858213
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TPMT
Proper citation: Atlas Antibodies Cat# HPA019851, RRID:AB_1858213 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1850624
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SAFB
Proper citation: Atlas Antibodies Cat# HPA020076, RRID:AB_1850624 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856283
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RINT1
Proper citation: Atlas Antibodies Cat# HPA019875, RRID:AB_1856283 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844802
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): AMPH
Proper citation: Atlas Antibodies Cat# HPA019829, RRID:AB_1844802 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858710
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MTPN
Proper citation: Atlas Antibodies Cat# HPA019735, RRID:AB_1858710 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849545
Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GC
Proper citation: Atlas Antibodies Cat# HPA019855, RRID:AB_1849545 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852699
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): LANCL2
Proper citation: Atlas Antibodies Cat# HPA019711, RRID:AB_1852699 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853910
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM221A
Proper citation: Atlas Antibodies Cat# HPA019719, RRID:AB_1853910 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.