Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 496 showing 9901 ~ 9920 out of 3,188,693 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678585

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RALGAPA2

Proper citation: Atlas Antibodies Cat# HPA043622, RRID:AB_2678585 Copy   


  • RRID:AB_10966214

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10966214

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): TBC1D21

Proper citation: Atlas Antibodies Cat# HPA043319, RRID:AB_10966214 Copy   


  • RRID:AB_2678547

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678547

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DYM

Proper citation: Atlas Antibodies Cat# HPA043551, RRID:AB_2678547 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678572

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LQLYYKSCDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLEDSYDLKSTLSSMGMSDA; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): SERPINB10

Proper citation: Atlas Antibodies Cat# HPA043595, RRID:AB_2678572 Copy   


  • RRID:AB_10959313

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10959313

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GMNC

Proper citation: Atlas Antibodies Cat# HPA043663, RRID:AB_10959313 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678614

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NLRP6

Proper citation: Atlas Antibodies Cat# HPA043681, RRID:AB_2678614 Copy   


  • RRID:AB_2678437

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678437

Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GNL1

Proper citation: Atlas Antibodies Cat# HPA043338, RRID:AB_2678437 Copy   


  • RRID:AB_10960215

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10960215

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FGF7

Proper citation: Atlas Antibodies Cat# HPA043605, RRID:AB_10960215 Copy   


  • RRID:AB_2678627

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678627

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CST2

Proper citation: Atlas Antibodies Cat# HPA043706, RRID:AB_2678627 Copy   


  • RRID:AB_2678403

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678403

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MPND

Proper citation: Atlas Antibodies Cat# HPA043274, RRID:AB_2678403 Copy   


  • RRID:AB_10797142

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10797142

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHLDB3

Proper citation: Atlas Antibodies Cat# HPA043425, RRID:AB_10797142 Copy   


  • RRID:AB_2678563

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678563

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): COPE

Proper citation: Atlas Antibodies Cat# HPA043576, RRID:AB_2678563 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678556

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EVI5L

Proper citation: Atlas Antibodies Cat# HPA043563, RRID:AB_2678556 Copy   


  • RRID:AB_2678617

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678617

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TUBA1A

Proper citation: Atlas Antibodies Cat# HPA043684, RRID:AB_2678617 Copy   


  • RRID:AB_2678450

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678450

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRND

Proper citation: Atlas Antibodies Cat# HPA043373, RRID:AB_2678450 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678521

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DCUN1D3

Proper citation: Atlas Antibodies Cat# HPA043511, RRID:AB_2678521 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678493

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC174

Proper citation: Atlas Antibodies Cat# HPA043468, RRID:AB_2678493 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678456

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM183A

Proper citation: Atlas Antibodies Cat# HPA043382, RRID:AB_2678456 Copy   


  • RRID:AB_10959470

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10959470

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RGL3

Proper citation: Atlas Antibodies Cat# HPA043615, RRID:AB_10959470 Copy   


  • RRID:AB_2678517

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678517

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UACA

Proper citation: Atlas Antibodies Cat# HPA043503, RRID:AB_2678517 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X