Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683699
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ACAP3
Proper citation: Atlas Antibodies Cat# HPA058381, RRID:AB_2683699 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683758
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH3D19
Proper citation: Atlas Antibodies Cat# HPA058562, RRID:AB_2683758 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683819
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RBMS2
Proper citation: Atlas Antibodies Cat# HPA058784, RRID:AB_2683819 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683762
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HEATR3
Proper citation: Atlas Antibodies Cat# HPA058579, RRID:AB_2683762 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683733
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PROSER3
Proper citation: Atlas Antibodies Cat# HPA058492, RRID:AB_2683733 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683790
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SGCB
Proper citation: Atlas Antibodies Cat# HPA058656, RRID:AB_2683790 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683736
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RFC4
Proper citation: Atlas Antibodies Cat# HPA058507, RRID:AB_2683736 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683675
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): BHMT
Proper citation: Atlas Antibodies Cat# HPA058310, RRID:AB_2683675 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683660
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NPPA
Proper citation: Atlas Antibodies Cat# HPA058269, RRID:AB_2683660 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683789
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FUT10
Proper citation: Atlas Antibodies Cat# HPA058655, RRID:AB_2683789 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683861
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): QDPR
Proper citation: Atlas Antibodies Cat# HPA058951, RRID:AB_2683861 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683876
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PITPNM3
Proper citation: Atlas Antibodies Cat# HPA059005, RRID:AB_2683876 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683687
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TOR1AIP2
Proper citation: Atlas Antibodies Cat# HPA058348, RRID:AB_2683687 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683649
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CEP72
Proper citation: Atlas Antibodies Cat# HPA058235, RRID:AB_2683649 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683413
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TEAD1
Proper citation: Atlas Antibodies Cat# HPA057339, RRID:AB_2683413 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683531
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): UBE2M
Proper citation: Atlas Antibodies Cat# HPA057800, RRID:AB_2683531 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683604
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence WGGSAMANSESKTANKRSASTEKLEQGTSALIRQMPLSSAGLQNSVAKRKTDKERSSSLNRRDSNLHSSTDKEQAER; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAP7D3
Proper citation: Atlas Antibodies Cat# HPA058101, RRID:AB_2683604 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683478
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ISCU
Proper citation: Atlas Antibodies Cat# HPA057592, RRID:AB_2683478 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683475
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NAT10
Proper citation: Atlas Antibodies Cat# HPA057576, RRID:AB_2683475 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683536
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RAMP1
Proper citation: Atlas Antibodies Cat# HPA057814, RRID:AB_2683536 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.