Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

56,319 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-PACS2 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA001423, RRID:AB_2156757 PACS2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2156757 Atlas Antibodies HPA001423 2026-08-29 04:22:33 1
Anti-CSF3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001412, RRID:AB_1079019 CSF3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFL; Manufacturer approved use: IHC polyclonal rabbit AB_1079019 Atlas Antibodies HPA001412 2026-08-29 08:18:21 0
Anti-NMT2 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA001303, RRID:AB_1079494 NMT2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079494 Atlas Antibodies HPA001303 2026-08-31 08:47:14 1
Anti-PNP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001625, RRID:AB_1854577 PNP rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1854577 Atlas Antibodies HPA001625 2026-08-29 10:38:37 0
Anti-CASP9 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001473, RRID:AB_1078401 CASP9 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078401 Atlas Antibodies HPA001473 2026-08-31 02:55:10 0
Anti-ICK polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001113, RRID:AB_1851385 ICK human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1851385 Atlas Antibodies HPA001113 2026-08-29 01:59:47 0
Anti-GAB2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001368, RRID:AB_2666287 GAB2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2666287 Atlas Antibodies HPA001368 2026-08-29 06:59:39 0
Anti-ERBB2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001383, RRID:AB_1078500 ERBB2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078500 Atlas Antibodies HPA001383 2026-08-29 01:14:50 0
Anti-OSBPL8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001309, RRID:AB_1079530 OSBPL8 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079530 Atlas Antibodies HPA001309 2026-08-29 01:35:10 0
Anti-KCND1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001066, RRID:AB_1079662 KCND1 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1079662 Atlas Antibodies HPA001066 2026-08-29 08:44:14 0
Anti-COMT polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001169, RRID:AB_1078402 COMT rat, human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078402 Atlas Antibodies HPA001169 2026-08-29 01:13:21 0
Anti-MPST polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA001240, RRID:AB_1079408 MPST human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079408 Atlas Antibodies HPA001240 2026-08-29 12:17:37 5
Anti-RBMY1A1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001534, RRID:AB_2178972 RBMY1A1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2178972 Atlas Antibodies HPA001534 2026-08-29 03:07:16 0
Anti-HSD17B10 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001432, RRID:AB_1078740 HSD17B10 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078740 Atlas Antibodies HPA001432 2026-08-31 10:35:33 0
Anti-SATB2
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA001042, RRID:AB_10601711 SATB2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10601711 Atlas Antibodies HPA001042 2026-08-29 07:36:23 2
Anti-APP
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001462, RRID:AB_1078185 APP human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
unknown rabbit AB_1078185 Atlas Antibodies HPA001462 2026-08-29 07:30:07 0
Anti-CDK16 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA001366, RRID:AB_1079584 CDK16 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079584 Atlas Antibodies HPA001366 2026-08-31 04:38:32 2
Anti-WDHD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001122, RRID:AB_1080589 WDHD1 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1080589 Atlas Antibodies HPA001122 2026-08-31 06:04:03 0
Anti-HNRNPA1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001609, RRID:AB_2666383 HNRNPA1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2666383 Atlas Antibodies HPA001609 2026-08-31 10:19:01 0
Anti-PTPN6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001466, RRID:AB_1855930 PTPN6 rat, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1855930 Atlas Antibodies HPA001466 2026-08-29 08:16:29 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.