Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078408
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CTSO
Proper citation: Atlas Antibodies Cat# HPA002041, RRID:AB_1078408 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848427
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FARSA
Proper citation: Atlas Antibodies Cat# HPA001911, RRID:AB_1848427 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078851
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): AHSG
Proper citation: Atlas Antibodies Cat# HPA001524, RRID:AB_1078851 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079732
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RAB39B
Proper citation: Atlas Antibodies Cat# HPA001114, RRID:AB_1079732 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666175
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DKC1
Proper citation: Atlas Antibodies Cat# HPA001022, RRID:AB_2666175 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079441
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MYO5A
Proper citation: Atlas Antibodies Cat# HPA001356, RRID:AB_1079441 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078645
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): DGCR14
Proper citation: Atlas Antibodies Cat# HPA001221, RRID:AB_1078645 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079135
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRF; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL23A
Proper citation: Atlas Antibodies Cat# HPA001554, RRID:AB_1079135 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078289
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): BMX
Proper citation: Atlas Antibodies Cat# HPA001048, RRID:AB_1078289 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666207
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PTGR2
Proper citation: Atlas Antibodies Cat# HPA001125, RRID:AB_2666207 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845558
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): VCPKMT
Proper citation: Atlas Antibodies Cat# HPA001146, RRID:AB_1845558 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080295
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TLR8
Proper citation: Atlas Antibodies Cat# HPA001608, RRID:AB_1080295 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079326
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MBNL3
Proper citation: Atlas Antibodies Cat# HPA001584, RRID:AB_1079326 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845480
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KLHL28
Proper citation: Atlas Antibodies Cat# HPA000988, RRID:AB_1845480 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079125
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CHUK
Proper citation: Atlas Antibodies Cat# HPA001402, RRID:AB_1079125 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079139
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IMPDH2
Proper citation: Atlas Antibodies Cat# HPA001400, RRID:AB_1079139 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2227189
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANGEL1
Proper citation: Atlas Antibodies Cat# HPA000948, RRID:AB_2227189 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080692
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF229
Proper citation: Atlas Antibodies Cat# HPA001494, RRID:AB_1080692 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079640
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZBTB16
Proper citation: Atlas Antibodies Cat# HPA001499, RRID:AB_1079640 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078704
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DRG1
Proper citation: Atlas Antibodies Cat# HPA001218, RRID:AB_1078704 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.