Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679536
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPK; Manufacturer approved use: ICC-IF, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): HOXA13
Proper citation: Atlas Antibodies Cat# HPA046098, RRID:AB_2679536 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679624
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PSG11
Proper citation: Atlas Antibodies Cat# HPA046327, RRID:AB_2679624 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679506
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DAZAP2
Proper citation: Atlas Antibodies Cat# HPA045940, RRID:AB_2679506 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960533
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): TAC3
Proper citation: Atlas Antibodies Cat# HPA045919, RRID:AB_10960533 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960266
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C19orf47
Proper citation: Atlas Antibodies Cat# HPA046309, RRID:AB_10960266 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960062
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GNG13
Proper citation: Atlas Antibodies Cat# HPA046272, RRID:AB_10960062 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679403
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): USP17L2
Proper citation: Atlas Antibodies Cat# HPA045642, RRID:AB_2679403 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679649
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC25A51
Proper citation: Atlas Antibodies Cat# HPA046388, RRID:AB_2679649 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963785
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TIFA
Proper citation: Atlas Antibodies Cat# HPA045889, RRID:AB_10963785 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962580
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MTCL1
Proper citation: Atlas Antibodies Cat# HPA046245, RRID:AB_10962580 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679573
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PDGFD
Proper citation: Atlas Antibodies Cat# HPA046183, RRID:AB_2679573 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961036
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPANXN4
Proper citation: Atlas Antibodies Cat# HPA045730, RRID:AB_10961036 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679554
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MAGEB18
Proper citation: Atlas Antibodies Cat# HPA046141, RRID:AB_2679554 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962728
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RGS18
Proper citation: Atlas Antibodies Cat# HPA045780, RRID:AB_10962728 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679615
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC189
Proper citation: Atlas Antibodies Cat# HPA046289, RRID:AB_2679615 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962003
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DNAH11
Proper citation: Atlas Antibodies Cat# HPA045880, RRID:AB_10962003 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963114
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SDHD
Proper citation: Atlas Antibodies Cat# HPA045727, RRID:AB_10963114 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679460
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRABD2B
Proper citation: Atlas Antibodies Cat# HPA045817, RRID:AB_2679460 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679627
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPAM
Proper citation: Atlas Antibodies Cat# HPA046339, RRID:AB_2679627 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679566
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSRQGLSLEERRHTEAICEHEALLSRLICRMINLLQSG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): ACCSL
Proper citation: Atlas Antibodies Cat# HPA046163, RRID:AB_2679566 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.