Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-DIO2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048002, RRID:AB_2680230 | DIO2 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680230 | Atlas Antibodies | HPA048002 | 2026-08-31 02:41:26 | 0 | ||
|
Anti-SLC35F2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048185, RRID:AB_2680304 | SLC35F2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680304 | Atlas Antibodies | HPA048185 | 2026-08-29 02:29:05 | 0 | ||
|
Anti-KIAA1191 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048145, RRID:AB_2680283 | KIAA1191 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680283 | Atlas Antibodies | HPA048145 | 2026-08-31 09:09:39 | 0 | ||
|
Anti-PAPD5 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048225, RRID:AB_2680319 | PAPD5 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680319 | Atlas Antibodies | HPA048225 | 2026-08-29 02:20:31 | 0 | ||
|
Anti-REG3A polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047894, RRID:AB_2680202 | REG3A | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680202 | Atlas Antibodies | HPA047894 | 2026-08-29 09:24:46 | 0 | ||
|
Anti-PRR15 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048121, RRID:AB_2680271 | PRR15 | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680271 | Atlas Antibodies | HPA048121 | 2026-08-29 02:53:03 | 0 | ||
|
Anti-ZIC3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047934, RRID:AB_2680217 | ZIC3 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV; Manufacturer approved use: ICC-IF | polyclonal | rabbit | AB_2680217 | Atlas Antibodies | HPA047934 | 2026-08-28 10:28:47 | 0 | ||
|
Anti-OR5L2 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047524, RRID:AB_2680076 | OR5L2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680076 | Atlas Antibodies | HPA047524 | 2026-08-29 03:04:09 | 0 | ||
|
Anti-FAM84A polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047703, RRID:AB_2680123 | FAM84A | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680123 | Atlas Antibodies | HPA047703 | 2026-08-29 05:34:43 | 0 | ||
|
Anti-C3orf80 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047439, RRID:AB_10965171 | C3orf80 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10965171 | Atlas Antibodies | HPA047439 | 2026-08-28 11:46:30 | 0 | ||
|
Anti-PDRG1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047084, RRID:AB_2679925 | PDRG1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2679925 | Atlas Antibodies | HPA047084 | 2026-08-28 07:34:33 | 0 | ||
|
Anti-UEVLD polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047134, RRID:AB_10960698 | UEVLD | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10960698 | Atlas Antibodies | HPA047134 | 2026-08-31 07:36:22 | 0 | ||
|
Anti-BLCAP polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047390, RRID:AB_2680025 | BLCAP | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680025 | Atlas Antibodies | HPA047390 | 2026-08-31 06:08:20 | 0 | ||
|
Anti-PURG polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047746, RRID:AB_2680145 | PURG | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680145 | Atlas Antibodies | HPA047746 | 2026-08-31 11:33:24 | 0 | ||
|
Anti-RPS3A Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047100, RRID:AB_2679931 | RPS3A | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2679931 | Atlas Antibodies | HPA047100 | 2026-08-29 01:50:27 | 0 | ||
|
Anti-ALG11 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047214, RRID:AB_10961640 | ALG11 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10961640 | Atlas Antibodies | HPA047214 | 2026-08-29 05:06:29 | 0 | ||
|
Anti-MRPL22 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047063, RRID:AB_2679919 | MRPL22 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2679919 | Atlas Antibodies | HPA047063 | 2026-08-29 10:11:44 | 0 | ||
|
Anti-CEP19 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047614, RRID:AB_2680103 | CEP19 | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680103 | Atlas Antibodies | HPA047614 | 2026-08-29 07:37:52 | 0 | ||
|
Anti-CYP2A6 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047262, RRID:AB_2680005 | CYP2A6 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680005 | Atlas Antibodies | HPA047262 | 2026-08-31 03:43:44 | 0 | ||
|
Anti-TPPP3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA047629, RRID:AB_2680108 | TPPP3 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2680108 | Atlas Antibodies | HPA047629 | 2026-08-29 01:30:22 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
