Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851856
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IQGAP1
Proper citation: Atlas Antibodies Cat# HPA014055, RRID:AB_1851856 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852590
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KLHL5
Proper citation: Atlas Antibodies Cat# HPA013958, RRID:AB_1852590 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852112
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KCNE3
Proper citation: Atlas Antibodies Cat# HPA014849, RRID:AB_1852112 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847134
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GJE1
Proper citation: Atlas Antibodies Cat# HPA014916, RRID:AB_1847134 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855746
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PTGIS
Proper citation: Atlas Antibodies Cat# HPA014193, RRID:AB_1855746 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846990
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CMTM1
Proper citation: Atlas Antibodies Cat# HPA013801, RRID:AB_1846990 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854239
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): OMG
Proper citation: Atlas Antibodies Cat# HPA012693, RRID:AB_1854239 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847797
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DNAJC1
Proper citation: Atlas Antibodies Cat# HPA013432, RRID:AB_1847797 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847399
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PPIB
Proper citation: Atlas Antibodies Cat# HPA012720, RRID:AB_1847399 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845173
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATP1B1
Proper citation: Atlas Antibodies Cat# HPA012911, RRID:AB_1845173 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855328
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PLD2
Proper citation: Atlas Antibodies Cat# HPA013397, RRID:AB_1855328 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2668872
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DDRGK1
Proper citation: Atlas Antibodies Cat# HPA013705, RRID:AB_2668872 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847895
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DUSP27
Proper citation: Atlas Antibodies Cat# HPA012608, RRID:AB_1847895 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856271
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RHOT2
Proper citation: Atlas Antibodies Cat# HPA012895, RRID:AB_1856271 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2668852
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TYW1B
Proper citation: Atlas Antibodies Cat# HPA013568, RRID:AB_2668852 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2112577
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GRAMD1A
Proper citation: Atlas Antibodies Cat# HPA012570, RRID:AB_2112577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845683
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): APMAP
Proper citation: Atlas Antibodies Cat# HPA012863, RRID:AB_1845683 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855301
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UBAC2
Proper citation: Atlas Antibodies Cat# HPA013448, RRID:AB_1855301 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849698
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFSF18
Proper citation: Atlas Antibodies Cat# HPA012699, RRID:AB_1849698 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856729
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SERPINB6
Proper citation: Atlas Antibodies Cat# HPA012736, RRID:AB_1856729 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.