Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

56,319 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-LATS2 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA049037, RRID:AB_2680609 LATS2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680609 Atlas Antibodies HPA049037 2026-08-29 08:19:51 1
Anti-MAPT polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048895, RRID:AB_2680550 MAPT human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680550 Atlas Antibodies HPA048895 2026-08-29 12:19:50 0
Anti-FAM104B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049082, RRID:AB_2680625 FAM104B human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680625 Atlas Antibodies HPA049082 2026-08-31 07:48:44 0
Anti-CACNA1S polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048892, RRID:AB_2680548 CACNA1S human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680548 Atlas Antibodies HPA048892 2026-08-31 06:08:21 0
Anti-RAE1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048795, RRID:AB_2680523 RAE1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680523 Atlas Antibodies HPA048795 2026-08-29 05:17:41 0
Anti-TUB polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049019, RRID:AB_2680601 TUB human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680601 Atlas Antibodies HPA049019 2026-08-31 04:35:57 0
Anti-SRP54 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048977, RRID:AB_2680583 SRP54 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680583 Atlas Antibodies HPA048977 2026-08-29 12:46:50 0
Anti-KCNQ1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA048553, RRID:AB_2680438 KCNQ1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680438 Atlas Antibodies HPA048553 2026-08-31 02:41:26 1
Anti-BRCC3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048737, RRID:AB_2680504 BRCC3 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680504 Atlas Antibodies HPA048737 2026-08-29 12:10:14 0
Anti-OR4C3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049116, RRID:AB_2680638 OR4C3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680638 Atlas Antibodies HPA049116 2026-08-29 12:10:14 0
Anti-PTH polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048540, RRID:AB_2680435 PTH human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680435 Atlas Antibodies HPA048540 2026-08-31 06:08:20 0
Anti-PLG polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048823, RRID:AB_2680532 PLG human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680532 Atlas Antibodies HPA048823 2026-08-31 08:34:40 0
Anti-POLDIP3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048790, RRID:AB_2680522 POLDIP3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680522 Atlas Antibodies HPA048790 2026-08-29 02:29:05 0
Anti-RFX2
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA048969, RRID:AB_2680577 RFX2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2680577 Atlas Antibodies HPA048969 2026-08-29 05:48:07 3
Anti-RNF222 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048916, RRID:AB_2680555 RNF222 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680555 Atlas Antibodies HPA048916 2026-08-29 02:02:47 0
Anti-RPS9 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048746, RRID:AB_2680510 RPS9 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680510 Atlas Antibodies HPA048746 2026-08-31 05:40:11 0
Anti-PLEKHJ1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048989, RRID:AB_2680590 PLEKHJ1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680590 Atlas Antibodies HPA048989 2026-08-28 04:54:54 0
Anti-INTS7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048769, RRID:AB_2680516 INTS7 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LTGLQEENYSSALSCIAESLKFYHKGIASLTAASTPLNPLSFQCEFVKLRIDLLQAFSQLICTCNSLKTSPPPAIATTIAMTLGNDLQRCGRISNQMKQSM; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2680516 Atlas Antibodies HPA048769 2026-08-31 03:19:57 0
Anti-GAS2L3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048593, RRID:AB_2680455 GAS2L3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680455 Atlas Antibodies HPA048593 2026-08-29 05:03:28 0
Anti-CBX6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048653, RRID:AB_2680479 CBX6 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680479 Atlas Antibodies HPA048653 2026-08-29 12:46:49 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.