Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10793928
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARMC6
Proper citation: Atlas Antibodies Cat# HPA041681, RRID:AB_10793928 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685283
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PAX8
Proper citation: Atlas Antibodies Cat# HPA064554, RRID:AB_2685283 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2620206
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): PSMD4
Proper citation: Bethyl Cat# A303-855A, RRID:AB_2620206 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685454
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLIC6
Proper citation: Atlas Antibodies Cat# HPA065285, RRID:AB_2685454 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675378
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PDE8B
Proper citation: Atlas Antibodies Cat# HPA036911, RRID:AB_2675378 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600731
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): THTPA
Proper citation: Atlas Antibodies Cat# HPA028876, RRID:AB_10600731 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611963
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EPB41L3
Proper citation: Atlas Antibodies Cat# HPA028605, RRID:AB_10611963 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681686
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RPL32
Proper citation: Atlas Antibodies Cat# HPA051994, RRID:AB_2681686 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078727
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EIF4ENIF1
Proper citation: Atlas Antibodies Cat# HPA001619, RRID:AB_1078727 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080427
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ERP44
Proper citation: Atlas Antibodies Cat# HPA001318, RRID:AB_1080427 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10981610
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PABPN1L
Proper citation: Atlas Antibodies Cat# HPA043415, RRID:AB_10981610 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676316
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence FSPSHKTTRFGTLFERLNSLGNRNLLTKSPAVIMDEDCRSTDEIRQSDYITEKHSIQHIWGKNGKEVSNFLEDVNQSTPNLLSENCDSFVS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): C12orf40
Proper citation: Atlas Antibodies Cat# HPA039032, RRID:AB_2676316 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853626
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): MCM3AP antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021527, RRID:AB_1853626 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854263
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): MSTN antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021681, RRID:AB_1854263 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845207
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATP8B1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018673, RRID:AB_1845207 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078393
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): CA2
Proper citation: Sigma-Aldrich Cat# HPA001550, RRID:AB_1078393 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10598917
Comments: Vendor recommendations: Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): XPNPEP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030419, RRID:AB_10598917 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079085
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human HS3ST1
Proper citation: Sigma-Aldrich Cat# HPA002237, RRID:AB_1079085 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845709
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human C21orf88
Proper citation: Sigma-Aldrich Cat# HPA021156, RRID:AB_1845709 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855410
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): PITPNM2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA003414, RRID:AB_1855410 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.