Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 411 showing 8201 ~ 8220 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_2681899

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681899

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): JPH2

Proper citation: Atlas Antibodies Cat# HPA052646, RRID:AB_2681899 Copy   


  • RRID:AB_1079273

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079273

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDM; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRAT

Proper citation: Atlas Antibodies Cat# HPA008397, RRID:AB_1079273 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601937

Host Organism: rabbit
Clonality: polyclonal
Target(s): LCN8 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA027491, RRID:AB_10601937 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10599193

Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): CSGALNACT2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA031539, RRID:AB_10599193 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601771

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNN antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA026726, RRID:AB_10601771 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601468

Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM57B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA030837, RRID:AB_10601468 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10600915

Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM199 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA027051, RRID:AB_10600915 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1849482

Comments: Vendor recommendations: Immunohistochemistry; Immunofluorescence; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GART antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA002119, RRID:AB_1849482 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845117

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): ASS1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA020896, RRID:AB_1845117 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672601

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): C1orf196 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA037610, RRID:AB_10672601 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672504

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRRC14B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA038046, RRID:AB_10672504 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795044

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): BHMT2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA044573, RRID:AB_10795044 Copy   


Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1604188

Comments: Applications: IHC
Original Manufacturer
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): BRD4

Proper citation: Bethyl Cat# IHC-00396, RRID:AB_1604188 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794915

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): C2orf80 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA042639, RRID:AB_10794915 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858062

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human TMCO5B

Proper citation: Sigma-Aldrich Cat# HPA014911, RRID:AB_1858062 Copy   


  • RRID:AB_2269266

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2269266

Comments: Originating manufacturer of this product.
Applications: WB, IP, IHC, IF, ELISA
Consolidation on 7/2020: AB_2269266, AB_2616312.
Host Organism: rabbit
Clonality: polyclonal
Target(s): RBM3

Proper citation: Proteintech Cat# 14363-1-AP, RRID:AB_2269266 Copy   


  • RRID:AB_1078978

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078978

Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): G6PD antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA000247, RRID:AB_1078978 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078694

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): DNAJC15 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA007988, RRID:AB_1078694 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079898

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): SCG3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA006880, RRID:AB_1079898 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079731

Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): RAB3A antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA003160, RRID:AB_1079731 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X