Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681899
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): JPH2
Proper citation: Atlas Antibodies Cat# HPA052646, RRID:AB_2681899 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079273
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EDKGRNSFYETSSFHRGDVLEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDM; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRAT
Proper citation: Atlas Antibodies Cat# HPA008397, RRID:AB_1079273 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601937
Host Organism: rabbit
Clonality: polyclonal
Target(s): LCN8 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA027491, RRID:AB_10601937 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599193
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): CSGALNACT2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031539, RRID:AB_10599193 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601771
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNN antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026726, RRID:AB_10601771 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601468
Comments: Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM57B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030837, RRID:AB_10601468 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600915
Comments: Vendor recommendations: Immunohistochemistry; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM199 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027051, RRID:AB_10600915 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849482
Comments: Vendor recommendations: Immunohistochemistry; Immunofluorescence; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GART antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA002119, RRID:AB_1849482 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845117
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): ASS1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA020896, RRID:AB_1845117 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672601
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): C1orf196 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037610, RRID:AB_10672601 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672504
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRRC14B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA038046, RRID:AB_10672504 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795044
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): BHMT2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044573, RRID:AB_10795044 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1604188
Comments: Applications: IHC
Original Manufacturer
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): BRD4
Proper citation: Bethyl Cat# IHC-00396, RRID:AB_1604188 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794915
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): C2orf80 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042639, RRID:AB_10794915 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858062
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human TMCO5B
Proper citation: Sigma-Aldrich Cat# HPA014911, RRID:AB_1858062 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2269266
Comments: Originating manufacturer of this product.
Applications: WB, IP, IHC, IF, ELISA
Consolidation on 7/2020: AB_2269266, AB_2616312.
Host Organism: rabbit
Clonality: polyclonal
Target(s): RBM3
Proper citation: Proteintech Cat# 14363-1-AP, RRID:AB_2269266 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078978
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): G6PD antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA000247, RRID:AB_1078978 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078694
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): DNAJC15 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007988, RRID:AB_1078694 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079898
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): SCG3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA006880, RRID:AB_1079898 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079731
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): RAB3A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA003160, RRID:AB_1079731 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
