Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-CPNE6
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031636, RRID:AB_10601203 CPNE6 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10601203 Atlas Antibodies HPA031636 2025-08-19 02:51:52 0
HES1-human
 
Resource Report
Resource Website
Rating or validation data
CDI Cat# R159.4.1B11, RRID:AB_2615995 HES1 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 20130125.RAP for not specified; status is not pursued unknown mouse AB_2615995 CDI R159.4.1B11 (also ENCAB000BER) 2025-08-19 02:51:51 0
Anti-TLE3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054116, RRID:AB_2682386 TLE3 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682386 Atlas Antibodies HPA054116 2025-08-19 02:52:01 0
Anti-OR52N1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054028, RRID:AB_2682348 OR52N1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682348 Atlas Antibodies HPA054028 2025-08-19 02:51:52 0
Anti-QRICH1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037677, RRID:AB_10671883 QRICH1 Human, Rat, Mouse Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671883 Atlas Antibodies HPA037677 2025-08-19 02:52:00 0
Anti-TACC3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA006050, RRID:AB_2667505 TACC3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRILSPSMASKLEAPFTQDDTLGLENSHPVWTQKEN; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2667505 Atlas Antibodies HPA006050 2025-08-19 02:51:52 0
Anti-C11orf95 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045002, RRID:AB_2679179 C11orf95 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679179 Atlas Antibodies HPA045002 2025-08-19 02:52:00 0
Anti-BPIL3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043057, RRID:AB_10796683 BPIL3 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10796683 Sigma-Aldrich HPA043057 2025-08-19 02:52:04 0
Rabbit anti-RBM33 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A303-926A, RRID:AB_2620275 RBM33 mouse, human Applications: WB, IP
Original Manufacturer
polyclonal rabbit AB_2620275 Bethyl A303-926A (also A303-926A-M, OWL-A19409, A303-926A-T) 2025-08-19 02:51:51 0
Anti-CNTD2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045615, RRID:AB_2679390 CNTD2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679390 Atlas Antibodies HPA045615 2025-08-19 02:52:00 0
Anti-MORF4L2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054102, RRID:AB_2682379 MORF4L2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2682379 Atlas Antibodies HPA054102 2025-08-19 02:51:52 0
Anti-DCN
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA003315, RRID:AB_1078639 DCN human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1078639 Atlas Antibodies HPA003315 2025-08-19 02:51:52 1
Anti-FAM156A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056640, RRID:AB_2683200 FAM156A human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683200 Atlas Antibodies HPA056640 2025-08-19 02:52:01 0
Anti-WDR27 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037498, RRID:AB_2675509 WDR27 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675509 Atlas Antibodies HPA037498 2025-08-19 02:51:52 0
Anti-MTMR14 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054063, RRID:AB_2682365 MTMR14 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682365 Atlas Antibodies HPA054063 2025-08-19 02:52:00 0
Anti-ATP8A2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040033, RRID:AB_2676809 ATP8A2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676809 Atlas Antibodies HPA040033 2025-08-19 02:51:52 0
Anti-C5orf24 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA057749, RRID:AB_2683515 C5orf24 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683515 Atlas Antibodies HPA057749 2025-08-19 02:51:52 0
Anti-AAR2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048645, RRID:AB_2680475 AAR2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680475 Atlas Antibodies HPA048645 2025-08-19 02:51:52 0
Anti-ATP6V1H antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA023421, RRID:AB_1845202 Human ATP6V1H human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1845202 Sigma-Aldrich HPA023421 2025-08-19 02:46:19 0
Anti-SYN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA000397, RRID:AB_1080146 SYN1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1080146 Atlas Antibodies HPA000397 2025-08-19 02:46:20 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.