Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853960
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RIOX2
Proper citation: Atlas Antibodies Cat# HPA008080, RRID:AB_1853960 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681265
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLCO1B3
Proper citation: Atlas Antibodies Cat# HPA050892, RRID:AB_2681265 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683751
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QTSGLSPSRLSKSQGGEEEGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNAVNCSLF; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAF1
Proper citation: Atlas Antibodies Cat# HPA058548, RRID:AB_2683751 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686337
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC16A1
Proper citation: Atlas Antibodies Cat# HPA071055, RRID:AB_2686337 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667139
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CTCF
Proper citation: Atlas Antibodies Cat# HPA004122, RRID:AB_2667139 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10806501
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SCAMP4
Proper citation: Atlas Antibodies Cat# HPA043284, RRID:AB_10806501 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686308
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): USP34
Proper citation: Atlas Antibodies Cat# HPA070764, RRID:AB_2686308 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671724
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRAF3IP1
Proper citation: Atlas Antibodies Cat# HPA037858, RRID:AB_10671724 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079148
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): IRF4
Proper citation: Atlas Antibodies Cat# HPA002038, RRID:AB_1079148 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680647
Host Organism: rabbit
Clonality: unknown
Target(s): NXPE1
Proper citation: Sigma-Aldrich Cat# HPA049133, RRID:AB_2680647 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684860
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRR36
Proper citation: Atlas Antibodies Cat# HPA062741, RRID:AB_2684860 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2890601
Comments: This antibody was submitted as part of the SPARC dataset "Antibodies tested in the colon – Mouse" from the Tache lab
Host Organism: rabbit
Clonality: unknown
Target(s): pCHAT
Proper citation: Dr. Kimura Cat# KimuraPCHAT, RRID:AB_2890601 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2171026
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): PRPF39
Proper citation: Sigma-Aldrich Cat# HPA001176, RRID:AB_2171026 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858195
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TOR1B
Proper citation: Atlas Antibodies Cat# HPA013403, RRID:AB_1858195 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858301
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Other; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRIM42 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA022481, RRID:AB_1858301 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856834
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human SHMT2
Proper citation: Sigma-Aldrich Cat# HPA020549, RRID:AB_1856834 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854814
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): OSBPL3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA000691, RRID:AB_1854814 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10301319
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): XXbac-B461K10.4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA000639, RRID:AB_10301319 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600304
Comments: ENCODE PROJECT External validation DATA SET is released testing lot R28103 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality: polyclonal
Target(s): MTF1
Proper citation: Sigma-Aldrich Cat# HPA028604, RRID:AB_10600304 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602400
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC25A43 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA035188, RRID:AB_10602400 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
