Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-DOCK1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048692, RRID:AB_2680495 DOCK1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680495 Atlas Antibodies HPA048692 2025-08-19 02:50:06 0
Anti-ZNF300 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051777, RRID:AB_2681606 ZNF300 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681606 Atlas Antibodies HPA051777 2025-08-19 02:50:13 0
Anti-SUOX
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038209, RRID:AB_10672738 SUOX human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10672738 Atlas Antibodies HPA038209 2025-08-19 02:50:12 0
Anti-ADAMTS7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048453, RRID:AB_2680399 ADAMTS7 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680399 Atlas Antibodies HPA048453 2025-08-19 02:50:13 0
Anti-SEL1L3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040045, RRID:AB_10796116 SEL1L3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10796116 Atlas Antibodies HPA040045 2025-08-19 02:50:06 0
Anti-LGALS8
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA030491, RRID:AB_10602345 LGALS8 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10602345 Atlas Antibodies HPA030491 2025-08-19 02:50:05 1
Anti-SLC35E1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA062214, RRID:AB_2684713 SLC35E1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684713 Atlas Antibodies HPA062214 2025-08-19 02:50:06 0
Anti-DBF4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042923, RRID:AB_2678222 DBF4 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678222 Atlas Antibodies HPA042923 2025-08-19 02:50:12 0
Rabbit anti-RNA Polymerase II Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A300-653A, RRID:AB_519334 RNA Polymerase II mouse, human Applications: WB, IP polyclonal rabbit AB_519334 Bethyl A300-653A (also A300-653A-M, A300-653A-T) 2025-08-19 02:50:11 4
Anti-NR1I2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA055121, RRID:AB_2682703 NR1I2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682703 Atlas Antibodies HPA055121 2025-08-19 02:50:06 0
Anti-ARNT polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001759, RRID:AB_1078213 ARNT human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078213 Atlas Antibodies HPA001759 2025-08-19 02:50:12 0
Melan A, Melanoma Antigen Recognized by T-Cells
 
Resource Report
Resource Website
Rating or validation data
Innovative Research Cat# 18-7263, RRID:AB_2336054 MART-1 fusion protein [A103/M2-7C10/M2-9E3] Used By NYUIHC-1147
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_2336054 Innovative Research 18-7263 2025-08-19 02:50:15 0
Anti-KARS antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA041550, RRID:AB_10794520 KARS antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10794520 Sigma-Aldrich HPA041550 2025-08-19 02:42:21 0
Anti-ACAA1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA006764, RRID:AB_1078085 Human ACAA1 human Vendor recommendations: unknown rabbit AB_1078085 Sigma-Aldrich HPA006764 2025-08-19 02:42:20 0
ATP-Citrate Lyase Antibody
 
Resource Report
Resource Website
10+ mentions
Rating or validation data
Cell Signaling Technology Cat# 4332, RRID:AB_2223744 Acly rat, mouse, human Applications: W. Consolidation on 10/2018: AB_10695144, AB_2223744.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
polyclonal rabbit AB_2223744 Cell Signaling Technology 4332 2025-08-19 02:42:24 23
NR1H2-human
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# SAB3500380, RRID:AB_10637523 NR1H2 homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 55791001 for not specified; status is not pursued polyclonal rabbit AB_10637523 Sigma-Aldrich SAB3500380 2025-08-19 02:42:31 0
Anti-DNAJC12 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA058161, RRID:AB_2683626 DNAJC12 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ESDKTHTTKMENEECNEQRERKKEELASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSE; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2683626 Atlas Antibodies HPA058161 2025-08-19 02:42:32 0
Anti-CLOCK antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA027565, RRID:AB_1846975 Human CLOCK human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1846975 Sigma-Aldrich HPA027565 2025-08-19 02:42:39 0
Anti-DPEP3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031870, RRID:AB_2674079 DPEP3 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2674079 Atlas Antibodies HPA031870 2025-08-19 02:42:37 0
Anti-RASGRP1 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039389, RRID:AB_2732481 RASGRP1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732481 Atlas Antibodies HPA039389 2025-08-19 02:42:40 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.