Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685981
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SOX17
Proper citation: Atlas Antibodies Cat# HPA068399, RRID:AB_2685981 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732348
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PPP1R36
Proper citation: Atlas Antibodies Cat# HPA077492, RRID:AB_2732348 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078582
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CTAGE5
Proper citation: Atlas Antibodies Cat# HPA000387, RRID:AB_1078582 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677575
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FTL
Proper citation: Atlas Antibodies Cat# HPA041602, RRID:AB_2677575 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674607
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SCN3A
Proper citation: Atlas Antibodies Cat# HPA035396, RRID:AB_2674607 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683700
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BACH2
Proper citation: Atlas Antibodies Cat# HPA058384, RRID:AB_2683700 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673019
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QDETYEVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): CACNA1C
Proper citation: Atlas Antibodies Cat# HPA039796, RRID:AB_10673019 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2753155
Comments: Applications: Immunoprecipitation
Host Organism: mouse
Clonality: monoclonal
Target(s): POLE3
Proper citation: CDI Cat# 14-310, RRID:AB_2753155 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11205464
Comments: Discontinued; Applications: IP (2-10 µg/mg lysate), WB (1:2,000-1:10,000)
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): HO-1
Proper citation: Thermo Fisher Scientific Cat# A303-662A, RRID:AB_11205464 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685084
Host Organism: rabbit
Clonality: unknown
Target(s): SGTB
Proper citation: Sigma-Aldrich Cat# HPA063674, RRID:AB_2685084 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857666
Host Organism: rabbit
Clonality: polyclonal
Target(s): SURF1
Proper citation: Atlas Antibodies Cat# HPA021029, RRID:AB_1857666 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2111744
Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): GIGYF1
Proper citation: Sigma-Aldrich Cat# HPA020999, RRID:AB_2111744 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11160961
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 1 for HepG2; status is awaiting lab characterization
Host Organism: rabbit
Clonality: unknown
Target(s): NONO
Proper citation: MBL International Cat# RN092PW, RRID:AB_11160961 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_257881
Comments: Vendor recommendations: indirect immunofluorescence: 1:500; Immunofluorescence; Immunohistochemistry; Other; Western Blot
Consolidation on 7/2020: AB_257881, AB_10060322._x000D_\n
Host Organism: rabbit
Clonality: polyclonal
Target(s): Synthetic peptide sequence corresponding to amino acid residues 1814-1829 of rat afadin with N-terminal cysteine conjugated to maleimide-activated KLH.
Proper citation: Sigma-Aldrich Cat# A0349, RRID:AB_257881 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857627
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human STXBP3
Proper citation: Sigma-Aldrich Cat# HPA027225, RRID:AB_1857627 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845286
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human BBS9
Proper citation: Sigma-Aldrich Cat# HPA021289, RRID:AB_1845286 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858721
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human VASP
Proper citation: Sigma-Aldrich Cat# HPA005724, RRID:AB_1858721 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_631515
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: IgY Western Blot; Immunofluorescence; Immunohistochemistry; Immunoprecipitation; ELISA; Immunocytochemistry; WB, IP, IF, IHC(P), ELISA
Host Organism: human
Clonality: polyclonal
Target(s): Fos B (102)
Proper citation: Santa Cruz Biotechnology Cat# sc-48, RRID:AB_631515 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849952
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GRAMD3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA010095, RRID:AB_1849952 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849659
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human GHRL
Proper citation: Sigma-Aldrich Cat# HPA014246, RRID:AB_1849659 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
