Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960563
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): CHST5 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043804, RRID:AB_10960563 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848642
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): WIPI1
Proper citation: Atlas Antibodies Cat# HPA007493, RRID:AB_1848642 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078907
Comments: Vendor recommendations: Other; Immunofluorescence; Immunohistochemistry; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): FOXP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA003876, RRID:AB_1078907 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_631263
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Flow Cytometry; Immunocytochemistry; Immunofluorescence; Immunohistochemistry; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, Immunohistochemistry(P), Flow Cytometry, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): JUN
Proper citation: Santa Cruz Biotechnology Cat# sc-1694, RRID:AB_631263 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856409
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human C1orf91
Proper citation: Sigma-Aldrich Cat# HPA015049, RRID:AB_1856409 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1851288
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human HTATIP2
Proper citation: Sigma-Aldrich Cat# HPA024321, RRID:AB_1851288 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854949
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human PALMD
Proper citation: Sigma-Aldrich Cat# HPA017959, RRID:AB_1854949 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673919
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HSCB
Proper citation: Atlas Antibodies Cat# HPA031518, RRID:AB_2673919 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601262
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DAP
Proper citation: Atlas Antibodies Cat# HPA029456, RRID:AB_10601262 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669638
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NALCN
Proper citation: Atlas Antibodies Cat# HPA031889, RRID:AB_10669638 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845035
Comments: Applications: ICC-IF, IHC, protein array:, immunohistochemistry (formalin-fixed, paraffin-embedded sections)
Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence HESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGSFRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRD
Consolidation on 6/2023: AB_1233489
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARMC9
Proper citation: Atlas Antibodies Cat# HPA019041, RRID:AB_1845035 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844693
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): AKAP4
Proper citation: Atlas Antibodies Cat# HPA020046, RRID:AB_1844693 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848968
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FMO3
Proper citation: Atlas Antibodies Cat# HPA013750, RRID:AB_1848968 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680652
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZKSCAN2
Proper citation: Atlas Antibodies Cat# HPA049141, RRID:AB_2680652 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_263412
Comments: Discontinued: 2021; Original Manufacturer; Applications: WB, IP, IHC-P, IF
Host Organism: rabbit
Clonality: unknown
Target(s): hSET1
Proper citation: Bethyl Cat# A300-288A, RRID:AB_263412 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855508
Host Organism: rabbit
Clonality: polyclonal
Target(s): PODN
Proper citation: Atlas Antibodies Cat# HPA013892, RRID:AB_1855508 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855300
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PHGDH
Proper citation: Atlas Antibodies Cat# HPA024031, RRID:AB_1855300 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845588
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human UTP6
Proper citation: Sigma-Aldrich Cat# HPA025936, RRID:AB_1845588 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847687
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human TECPR1
Proper citation: Sigma-Aldrich Cat# HPA021061, RRID:AB_1847687 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858703
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): UTS2D antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026992, RRID:AB_1858703 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.