Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678720
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MYBPC3
Proper citation: Atlas Antibodies Cat# HPA043898, RRID:AB_2678720 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671738
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPATA7
Proper citation: Atlas Antibodies Cat# HPA038082, RRID:AB_10671738 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682380
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): EPB41L1
Proper citation: Atlas Antibodies Cat# HPA054104, RRID:AB_2682380 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856000
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RAB27B
Proper citation: Atlas Antibodies Cat# HPA019849, RRID:AB_1856000 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684343
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GK
Proper citation: Atlas Antibodies Cat# HPA060687, RRID:AB_2684343 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078961
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GCNT3
Proper citation: Atlas Antibodies Cat# HPA011154, RRID:AB_1078961 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601453
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANKFY1
Proper citation: Atlas Antibodies Cat# HPA024522, RRID:AB_10601453 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685775
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLASP2
Proper citation: Atlas Antibodies Cat# HPA067071, RRID:AB_2685775 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681421
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANKRD18A
Proper citation: Atlas Antibodies Cat# HPA051288, RRID:AB_2681421 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795125
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPENFFIDPFTGHSYSTQDEHFLGIESLWNHKNYWINMQDCWNCCKDLIFDLGDPVRWEYMLLGTDKSQLSLTEEDDSGINDEDDVENLGKE; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): DRC7
Proper citation: Atlas Antibodies Cat# HPA041521, RRID:AB_10795125 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683020
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF629
Proper citation: Atlas Antibodies Cat# HPA056051, RRID:AB_2683020 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_571884
Comments: Applications: FC
Host Organism: mouse
Clonality: monoclonal
Target(s): CD206
Proper citation: BioLegend Cat# 321109, RRID:AB_571884 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10631979
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRP6
Proper citation: Bethyl Cat# A302-773A, RRID:AB_10631979 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601463
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): C6orf118 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029788, RRID:AB_10601463 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849318
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPRC5A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA007928, RRID:AB_1849318 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602711
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): MYBPC1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027614, RRID:AB_10602711 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599733
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): MTX2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031550, RRID:AB_10599733 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603672
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPR183 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028847, RRID:AB_10603672 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858808
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): DCAF8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027381, RRID:AB_1858808 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079194
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human IGSF9B
Proper citation: Sigma-Aldrich Cat# HPA010802, RRID:AB_1079194 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.