Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

54,543 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Authority Vendor Catalog Number Record Last Update Mentions Count
Anti-GLS polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036223, RRID:AB_10669984) GLS human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10669984 Antibody Registry Atlas Antibodies HPA036223 2024-07-24 11:44:20 0
Anti-ZNF385D polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036190, RRID:AB_10602355) ZNF385D human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602355 Antibody Registry Atlas Antibodies HPA036190 2024-07-24 11:09:44 0
Anti-EXOSC7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036182, RRID:AB_10673346) EXOSC7 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673346 Antibody Registry Atlas Antibodies HPA036182 2024-07-25 01:23:05 0
Anti-SH3BP5
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036445, RRID:AB_10670106) SH3BP5 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10670106 Antibody Registry Atlas Antibodies HPA036445 2024-07-25 12:50:53 0
Anti-PYURF polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036455, RRID:AB_10673388) PYURF human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673388 Antibody Registry Atlas Antibodies HPA036455 2024-07-24 06:37:12 0
Anti-FAM98A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036250, RRID:AB_2675020) FAM98A human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675020 Antibody Registry Atlas Antibodies HPA036250 2024-07-24 10:15:24 0
Anti-ACY1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036174, RRID:AB_2674988) ACY1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2674988 Antibody Registry Atlas Antibodies HPA036174 2024-07-24 09:18:44 0
Anti-IMMT
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036165, RRID:AB_2674980) IMMT human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2674980 Antibody Registry Atlas Antibodies HPA036165 2024-07-24 10:30:11 0
Anti-LARP1B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036280, RRID:AB_10673126) LARP1B human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673126 Antibody Registry Atlas Antibodies HPA036280 2024-07-25 02:35:11 0
Anti-ATP11B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036237, RRID:AB_10673123) ATP11B human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673123 Antibody Registry Atlas Antibodies HPA036237 2024-07-25 03:11:48 0
Anti-FBXL17 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036410, RRID:AB_2675109) FBXL17 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675109 Antibody Registry Atlas Antibodies HPA036410 2024-07-24 05:44:56 0
Anti-HOMEZ
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036317, RRID:AB_10669787) HOMEZ human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10669787 Antibody Registry Atlas Antibodies HPA036317 2024-07-24 08:07:33 0
Anti-C6orf58
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036263, RRID:AB_10673349) C6orf58 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10673349 Antibody Registry Atlas Antibodies HPA036263 2024-07-24 10:17:51 0
Anti-UROC1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036254, RRID:AB_2675023) UROC1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIG; Manufacturer approved use: IHC polyclonal rabbit AB_2675023 Antibody Registry Atlas Antibodies HPA036254 2024-07-24 09:11:34 0
Anti-SLC35A2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036087, RRID:AB_10604093) SLC35A2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10604093 Antibody Registry Atlas Antibodies HPA036087 2024-07-25 02:54:33 0
Anti-PTHLH
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA035982, RRID:AB_10794631) PTHLH human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10794631 Antibody Registry Atlas Antibodies HPA035982 2024-07-24 04:31:30 0
Anti-C1orf52 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036072, RRID:AB_10602696) C1orf52 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602696 Antibody Registry Atlas Antibodies HPA036072 2024-07-24 07:45:14 0
Anti-SIDT1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA035862, RRID:AB_10671110) SIDT1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671110 Antibody Registry Atlas Antibodies HPA035862 2024-07-24 06:28:37 0
Anti-DPP9 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA036059, RRID:AB_10671240) DPP9 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671240 Antibody Registry Atlas Antibodies HPA036059 2024-07-24 07:13:49 0
Anti-MMRN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA035769, RRID:AB_10696511) MMRN1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10696511 Antibody Registry Atlas Antibodies HPA035769 2024-07-24 10:25:27 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.