Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-PPP4R3A polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA002568, RRID:AB_1079207 PPP4R3A human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079207 Atlas Antibodies HPA002568 2025-08-19 03:51:56 1
Anti-SH2D1B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054791, RRID:AB_2682600 SH2D1B human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682600 Atlas Antibodies HPA054791 2025-08-19 03:51:57 0
Anti-NUP210 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA066888, RRID:AB_2685741 NUP210 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685741 Atlas Antibodies HPA066888 2025-08-19 03:52:52 0
Anti-ZNF747 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA069173, RRID:AB_2686097 ZNF747 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686097 Atlas Antibodies HPA069173 2025-08-19 03:51:57 0
Anti-NOSIP
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043464, RRID:AB_10794284 NOSIP human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10794284 Atlas Antibodies HPA043464 2025-08-19 03:51:56 0
Anti-PAPOLA antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA001788, RRID:AB_1079564 PAPOLA antibody produced in rabbit human Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry polyclonal rabbit AB_1079564 Sigma-Aldrich HPA001788 2025-08-19 03:53:00 0
Anti-IGBP1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA000634, RRID:AB_1079102 IGBP1 antibody produced in rabbit human Vendor recommendations: Other; Western Blot; Immunohistochemistry; Immunofluorescence; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1079102 Sigma-Aldrich HPA000634 2025-08-19 03:52:41 0
Anti-SEPT7 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA023309, RRID:AB_10600093 SEPT7 antibody produced in rabbit human Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Western Blot; Other polyclonal rabbit AB_10600093 Sigma-Aldrich HPA023309 2025-08-19 03:53:03 0
Anti-ABHD6 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA017283, RRID:AB_1844452 ABHD6 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1844452 Sigma-Aldrich HPA017283 2025-08-19 03:52:47 0
Anti-UPP2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA035225, RRID:AB_10604002 UPP2 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10604002 Sigma-Aldrich HPA035225 2025-08-19 03:52:55 0
Anti-mTOR Antibody, Unconjugated
 
Resource Report
Resource Website
100+ mentions
Rating or validation data
Cell Signaling Technology Cat# 2972, RRID:AB_330978 mTOR rat, mouse, human Applications: W, IP. Consolidation on 9/2016: AB_10695460. unknown AB_330978 Cell Signaling Technology 2972 (also 2972S) 2025-08-19 03:56:55 138
E (epithelial)-cadherin
 
Resource Report
Resource Website
Rating or validation data
Innovative Research Cat# 18-0223, RRID:AB_2336031 Recombinant protein corresponding to the cytoplasmic domain of human E-Cadherin [4A2C7] Used By NYUIHC-118
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_2336031 Innovative Research 18-0223 2025-08-19 03:57:03 0
Anti-Matrin 3 antibody [EPR10635(B)]
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Abcam Cat# ab151714, RRID:AB_2491618 Synthetic peptide, corresponding to residues in Human Matrin 3 (UniProt: P43243) EPR10635(B) PMID:24686783 ENCODE Project Validation data monoclonal rabbit AB_2491618 Abcam ab151714 (also ENCAB789SRM) 2025-08-19 03:57:09 3
Anti-DEFB125
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043095, RRID:AB_10795611 DEFB125 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10795611 Atlas Antibodies HPA043095 2025-08-19 03:57:36 0
Anti-IZUMO4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045099, RRID:AB_2679214 IZUMO4 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDTMKELHLAIPAKITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQV; Manufacturer approved use: IHC polyclonal rabbit AB_2679214 Atlas Antibodies HPA045099 2025-08-19 03:57:36 0
Anti-OOSP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050914, RRID:AB_2681271 OOSP2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681271 Atlas Antibodies HPA050914 2025-08-19 03:57:15 0
Anti-TMEM119
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA052650, RRID:AB_2681901 TMEM119 human unknown rabbit AB_2681901 Sigma-Aldrich HPA052650 2025-08-19 03:57:37 0
Anti-CAPNS2 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059749, RRID:AB_2732639 CAPNS2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732639 Atlas Antibodies HPA059749 2025-08-19 03:57:40 0
Anti-PHLDB3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043425, RRID:AB_10797142 PHLDB3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10797142 Atlas Antibodies HPA043425 2025-08-19 03:57:15 0
Anti-BRAT1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA076508, RRID:AB_2686803 BRAT1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686803 Atlas Antibodies HPA076508 2025-08-19 03:57:36 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.