Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600814
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTAS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPHK1
Proper citation: Atlas Antibodies Cat# HPA028761, RRID:AB_10600814 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680070
Host Organism: rabbit
Clonality: unknown
Target(s): RPL32
Proper citation: Sigma-Aldrich Cat# HPA047501, RRID:AB_2680070 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676960
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CPEB1
Proper citation: Atlas Antibodies Cat# HPA040396, RRID:AB_2676960 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686007
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BCORL1
Proper citation: Atlas Antibodies Cat# HPA068568, RRID:AB_2686007 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600767
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM135A
Proper citation: Atlas Antibodies Cat# HPA031743, RRID:AB_10600767 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683076
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TBPL2
Proper citation: Atlas Antibodies Cat# HPA056241, RRID:AB_2683076 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616391
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality: unknown
Target(s): chd-3
Proper citation: SDIX Cat# 4889.00.02, RRID:AB_2616391 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844331
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RNF208
Proper citation: Atlas Antibodies Cat# HPA021256, RRID:AB_1844331 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959451
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SEC13
Proper citation: Atlas Antibodies Cat# HPA035292, RRID:AB_10959451 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2228026
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): BLOC1S1
Proper citation: Sigma-Aldrich Cat# HPA021381, RRID:AB_2228026 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962509
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Clonality: polyclonal
Target(s): TPRX1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044922, RRID:AB_10962509 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965181
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Clonality: polyclonal
Target(s): ARRDC1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044345, RRID:AB_10965181 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961154
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): DRGX antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043978, RRID:AB_10961154 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963577
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): GSPT2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044769, RRID:AB_10963577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847084
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human COLEC10
Proper citation: Sigma-Aldrich Cat# HPA024511, RRID:AB_1847084 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844915
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human ANAPC11
Proper citation: Sigma-Aldrich Cat# HPA021989, RRID:AB_1844915 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1966069
Comments: Discontinued: 2016; Original manufacturer of this product; Validation by IP/Western Blot was performed using ReliaBLOTᄄ Western Blot Gel 4-8%, 10 x 10 cm (Cat. No. WB101-40812G) and ReliaBLOTᄄ Reagents (Cat. No. WB120). Related products include ReliaBLOTᄄ IP/WB kits, buffers and reagents.IHC validation was performed using Immunohistochemistry Accessory Kit (Cat. # IHC-101). Applications: WB,IP,IHC Paraffin,IF Dilution: WB - 1:2,000 to 1:10,000 / IP - 2 to 5 ᄉg/mg lysate / IHC - 1:1,000 to 1:5,000. Epitope retrieval with citrate buffer pH6.0 is recommended for FFPE tissue sections. / IF - 1:500 to 1:2,500.
Host Organism: rabbit
Clonality: unknown
Target(s): Sp3
Proper citation: Bethyl Cat# A302-485A, RRID:AB_1966069 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848429
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAT1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023882, RRID:AB_1848429 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_558517
Comments: Discontinued: 2023; Applications: IHC (F) (Assay-dependent), ELISA (Assay-dependent)
Host Organism: mouse
Clonality: monoclonal
Target(s): Proinsulin
Proper citation: Thermo Fisher Scientific Cat# MA1-22710, RRID:AB_558517 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684555
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): IKBIP
Proper citation: Atlas Antibodies Cat# HPA061541, RRID:AB_2684555 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.