Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 362 showing 7221 ~ 7240 out of 3,187,669 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

http://antibodyregistry.org/AB_2521166

Comments: WB, IHC-P
Host Organism: rabbit
Clonality: unknown
Target(s): CPNE1

Proper citation: Creative Diagnostics Cat# DPABH-05291, RRID:AB_2521166 Copy   


http://antibodyregistry.org/AB_2656404

Comments: Applications: MACS Flow Cytometry
Antigen Distribution: B cells, T cells, endothelial cells
Host Organism: human
Clonality: monoclonal
Target(s): CD222

Proper citation: Miltenyi Biotec Cat# 130-100-871, RRID:AB_2656404 Copy   


http://antibodyregistry.org/AB_2611182

Comments: Immunohistochemistry,IF Microscopy,Western Blot, Anti-IP3 Antibody is suitable for use in WB, IP, and IHC
Host Organism: mouse
Clonality: monoclonal
Target(s): IP3 Receptor Antibody

Proper citation: Rockland Cat# 200-301-F77, RRID:AB_2611182 Copy   


http://antibodyregistry.org/AB_2618588

Comments: Application(s): Immunoprecipitation,Microarray; Date Deposited: 07/08/2015
Host Organism: mouse
Clonality: monoclonal
Target(s): EHMT2; Euchromatic histone-lysine N-methyltransferase 2

Proper citation: DSHB Cat# PCRP-EHMT2-3D9, RRID:AB_2618588 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10610279

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHACTR2

Proper citation: Atlas Antibodies Cat# HPA031725, RRID:AB_10610279 Copy   


Discontinued

http://antibodyregistry.org/AB_2571359

Comments: Discontinued; Dilution:WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.; Purification: Protein G Purified; Specificity: Detects ~75kDa.; This clone was listed and recorded at the vendor as S91-36. However this has now been confirmed to be K91/36 by the originator of the clone.
Host Organism: mouse
Clonality: monoclonal
Target(s): Synthetic peptide amino acids 477-498 of human Wave1/Wasp family1

Proper citation: StressMarq Biosciences Cat# SMC-381S, RRID:AB_2571359 Copy   


Discontinued

http://antibodyregistry.org/AB_2572830

Comments: Discontinued: 2017; Original Manufacturer eBioscience, now part of Thermo Fisher; Applications: IF (Assay-Dependent), IHC (P) (2.5 ug/mL), ICC (Assay-Dependent); Reactive Species: Human
Host Organism: mouse
Clonality: monoclonal
Target(s): Progesterone Receptor

Proper citation: Thermo Fisher Scientific Cat# 13-9764-80, RRID:AB_2572830 Copy   


  • RRID:AB_2616533

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2616533

Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality: unknown
Target(s): Psc

Proper citation: Vincenzo Pirrotta Cat# non-commercial Psc modENCODE antibody 1, RRID:AB_2616533 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682709

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM170B

Proper citation: Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 Copy   


  • RRID:AB_2543203

Discontinued

http://antibodyregistry.org/AB_2543203

Comments: Discontinued; Applications: Western Blot (1:100-500); Reactive Species: Human
Host Organism: rabbit
Clonality: polyclonal
Target(s): OR13C4

Proper citation: Thermo Fisher Scientific Cat# PA5-25703, RRID:AB_2543203 Copy   


http://antibodyregistry.org/AB_2518972

Comments: WB
Host Organism: rabbit
Clonality: unknown
Target(s): SOX9

Proper citation: Creative Diagnostics Cat# DPABH-25892, RRID:AB_2518972 Copy   


http://antibodyregistry.org/AB_2524780

Comments: WB
Host Organism: rabbit
Clonality: unknown
Target(s): C16ORF78

Proper citation: Creative Diagnostics Cat# DPABH-13040, RRID:AB_2524780 Copy   


http://antibodyregistry.org/AB_2514997

Comments: IP
Host Organism: rabbit
Clonality: unknown
Target(s): RUVBL2

Proper citation: Creative Diagnostics Cat# DPABH-19154, RRID:AB_2514997 Copy   


http://antibodyregistry.org/AB_2516405

Comments: WB
Host Organism: rabbit
Clonality: unknown
Target(s): PIAS3

Proper citation: Creative Diagnostics Cat# DPABH-21353, RRID:AB_2516405 Copy   


  • RRID:AB_2072056

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2072056

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CCDC146

Proper citation: Atlas Antibodies Cat# HPA020105, RRID:AB_2072056 Copy   


Discontinued

http://antibodyregistry.org/AB_10954774

Comments: Discontinued: 2015; Discontinued on 27 July 2015; manufacturer recommendations: Western Blot,E; Western Blot
Host Organism: mouse
Clonality: monoclonal
Target(s): Mouse Human TNK1 MAAG4712

Proper citation: Creative Biomart Cat# CAB-6905MH, RRID:AB_10954774 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2667540

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIF2C

Proper citation: Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 Copy   


http://antibodyregistry.org/AB_2520606

Comments: WB, ICC/IF
Host Organism: rabbit
Clonality: unknown
Target(s): NKIRAS2

Proper citation: Creative Diagnostics Cat# DPABH-04046, RRID:AB_2520606 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078701

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFRSF21

Proper citation: Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 Copy   


http://antibodyregistry.org/AB_1157092

Comments: functionality unknown, check validation data for this product with vendor
Host Organism: mouse
Clonality: monoclonal
Target(s): Clostridium tetani toxoid

Proper citation: Cell Sciences Cat# CSI17228, RRID:AB_1157092 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X