Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-CPNE1 (aa 250-537) polyclonal antibody Resource Report Resource Website |
Creative Diagnostics Cat# DPABH-05291, RRID:AB_2521166 | CPNE1 | mouse, human | WB, IHC-P | unknown | rabbit | AB_2521166 | Creative Diagnostics | DPABH-05291 | 2025-08-19 10:25:17 | 0 | ||
|
CD222 Antibody, anti-human, Biotin, REAfinity™ Resource Report Resource Website |
Miltenyi Biotec Cat# 130-100-871, RRID:AB_2656404 | CD222 | human | clone REA187 |
Applications: MACS Flow Cytometry Antigen Distribution: B cells, T cells, endothelial cells |
monoclonal | human | AB_2656404 | Miltenyi Biotec | 130-100-871 | 2025-08-19 10:25:22 | 0 | |
|
Anti-IP3 Receptor (MOUSE) Monoclonal Antibody - 200-301-F77 Resource Report Resource Website |
Rockland Cat# 200-301-F77, RRID:AB_2611182 | IP3 Receptor Antibody | rat | S24-18 | Immunohistochemistry,IF Microscopy,Western Blot, Anti-IP3 Antibody is suitable for use in WB, IP, and IHC | monoclonal | mouse | AB_2611182 | Rockland | 200-301-F77 | 2025-08-19 10:25:20 | 0 | |
|
EHMT2; Euchromatic histone-lysine N-methyltransferase 2 antibody - Protein Capture Reagents Program, produced by JHU/CDI; Protein Capture Reagents Program, produced by JHU/CDI Resource Report Resource Website |
DSHB Cat# PCRP-EHMT2-3D9, RRID:AB_2618588 | EHMT2; Euchromatic histone-lysine N-methyltransferase 2 | human | Application(s): Immunoprecipitation,Microarray; Date Deposited: 07/08/2015 | monoclonal | mouse | AB_2618588 | DSHB | PCRP-EHMT2-3D9 | 2025-08-19 10:25:21 | 0 | ||
|
Anti-PHACTR2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA031725, RRID:AB_10610279 | PHACTR2 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10610279 | Atlas Antibodies | HPA031725 | 2025-08-19 10:25:23 | 0 | ||
|
Mouse Anti-Human WAVE1/SCAR Monoclonal IgG1 Resource Report Resource Website Discontinued |
StressMarq Biosciences Cat# SMC-381S, RRID:AB_2571359 | Synthetic peptide amino acids 477-498 of human Wave1/Wasp family1 | human | K91/36 | Discontinued; Dilution:WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.; Purification: Protein G Purified; Specificity: Detects ~75kDa.; This clone was listed and recorded at the vendor as S91-36. However this has now been confirmed to be K91/36 by the originator of the clone. | monoclonal | mouse | AB_2571359 | StressMarq Biosciences | SMC-381S | 2025-08-19 10:25:20 | 0 | |
|
Progesterone Receptor Monoclonal Antibody (KMC912), Biotin, eBioscience Resource Report Resource Website Discontinued |
Thermo Fisher Scientific Cat# 13-9764-80, RRID:AB_2572830 | Progesterone Receptor | human | KMC912 | Discontinued: 2017; Original Manufacturer eBioscience, now part of Thermo Fisher; Applications: IF (Assay-Dependent), IHC (P) (2.5 ug/mL), ICC (Assay-Dependent); Reactive Species: Human | monoclonal | mouse | AB_2572830 | Thermo Fisher Scientific | 13-9764-80 (also 13-9764) | 2025-08-19 10:25:20 | 0 | |
|
Psc-dmelanogaster Resource Report Resource Website Rating or validation data |
Vincenzo Pirrotta Cat# non-commercial Psc modENCODE antibody 1, RRID:AB_2616533 | Psc | drosophila melanogaster | ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization | unknown | rabbit | AB_2616533 | Vincenzo Pirrotta | non-commercial Psc modENCODE antibody 1 (also ENCAB163ZJM) | 2025-08-19 10:25:21 | 0 | ||
|
Anti-TMEM170B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 | TMEM170B | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682709 | Atlas Antibodies | HPA055134 | 2025-08-19 10:25:26 | 0 | ||
|
OR13C4 Antibody Resource Report Resource Website Discontinued |
Thermo Fisher Scientific Cat# PA5-25703, RRID:AB_2543203 | OR13C4 | human | Discontinued; Applications: Western Blot (1:100-500); Reactive Species: Human | polyclonal | rabbit | AB_2543203 | Thermo Fisher Scientific | PA5-25703 | 2025-08-19 10:25:19 | 0 | ||
|
Anti-SOX9 (C-terminal) polyclonal antibody Resource Report Resource Website |
Creative Diagnostics Cat# DPABH-25892, RRID:AB_2518972 | SOX9 | human | WB | unknown | rabbit | AB_2518972 | Creative Diagnostics | DPABH-25892 | 2025-08-19 10:25:24 | 0 | ||
|
Anti-C16ORF78 (aa 71-120) polyclonal antibody Resource Report Resource Website |
Creative Diagnostics Cat# DPABH-13040, RRID:AB_2524780 | C16ORF78 | human | WB | unknown | rabbit | AB_2524780 | Creative Diagnostics | DPABH-13040 | 2025-08-19 10:25:24 | 0 | ||
|
Anti-RUVBL2 (aa 413-463) polyclonal antibody Resource Report Resource Website |
Creative Diagnostics Cat# DPABH-19154, RRID:AB_2514997 | RUVBL2 | human | IP | unknown | rabbit | AB_2514997 | Creative Diagnostics | DPABH-19154 | 2025-08-19 10:25:16 | 0 | ||
|
Anti-PIAS3 polyclonal antibody Resource Report Resource Website |
Creative Diagnostics Cat# DPABH-21353, RRID:AB_2516405 | PIAS3 | human | WB | unknown | rabbit | AB_2516405 | Creative Diagnostics | DPABH-21353 | 2025-08-19 10:25:17 | 0 | ||
|
Anti-CCDC146 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA020105, RRID:AB_2072056 | CCDC146 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2072056 | Atlas Antibodies | HPA020105 | 2025-08-19 10:25:23 | 0 | ||
|
Mouse Anti-Human TNK1 Monoclonal Antibody, MAAG4712 Resource Report Resource Website Discontinued |
Creative Biomart Cat# CAB-6905MH, RRID:AB_10954774 | Mouse Human TNK1 MAAG4712 | mouse, human | Discontinued: 2015; Discontinued on 27 July 2015; manufacturer recommendations: Western Blot,E; Western Blot | monoclonal | mouse | AB_10954774 | Creative Biomart | CAB-6905MH | 2025-08-19 10:25:26 | 0 | ||
|
Anti-KIF2C polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 | KIF2C | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF | polyclonal | rabbit | AB_2667540 | Atlas Antibodies | HPA006219 | 2025-08-19 10:25:23 | 0 | ||
|
Anti-NKIRAS2 (aa 129-191) polyclonal antibody Resource Report Resource Website |
Creative Diagnostics Cat# DPABH-04046, RRID:AB_2520606 | NKIRAS2 | human | WB, ICC/IF | unknown | rabbit | AB_2520606 | Creative Diagnostics | DPABH-04046 | 2025-08-19 10:25:24 | 0 | ||
|
Anti-TNFRSF21 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 | TNFRSF21 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1078701 | Atlas Antibodies | HPA006746 | 2025-08-19 10:25:23 | 0 | ||
|
Mouse Anti-Clostridium tetani toxoid Monoclonal Antibody, Unconjugated, Clone 14F5 Resource Report Resource Website |
Cell Sciences Cat# CSI17228, RRID:AB_1157092 | Clostridium tetani toxoid | Clone 14F5 | functionality unknown, check validation data for this product with vendor | monoclonal | mouse | AB_1157092 | Cell Sciences | CSI17228 | 2025-08-19 10:25:27 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
