Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 362 showing 7221 ~ 7240 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10604002

Comments: Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): UPP2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA035225, RRID:AB_10604002 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10670152

Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): C13orf15 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA035638, RRID:AB_10670152 Copy   


  • RRID:AB_2676374

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2676374

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PPIC

Proper citation: Atlas Antibodies Cat# HPA039163, RRID:AB_2676374 Copy   


  • RRID:AB_2681981

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681981

Host Organism: rabbit
Clonality: unknown
Target(s): SLC9A1

Proper citation: Sigma-Aldrich Cat# HPA052891, RRID:AB_2681981 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858405

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TSPAN2

Proper citation: Atlas Antibodies Cat# HPA015640, RRID:AB_1858405 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2243752

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): C6orf15

Proper citation: Sigma-Aldrich Cat# HPA001436, RRID:AB_2243752 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1903955

Comments: Applications: W, IP, IHC-P, IF-P, IF-IC, F
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): EGFR (L858R Mutant Specific) (43B2) Rabbit mAb detects endogenous levels of EGFR mutant L858R protein. Careful titration of this antibody may be required to obtain optimal specificity.

Proper citation: Cell Signaling Technology Cat# 3197, RRID:AB_1903955 Copy   


  • RRID:AB_2335901

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2335901

Comments: Used By NYUIHC-149
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): Human P-Cadherin aa. 72-259

Proper citation: BD Biosciences Cat# C24120, RRID:AB_2335901 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680650

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCND2

Proper citation: Atlas Antibodies Cat# HPA049138, RRID:AB_2680650 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680427

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM55B

Proper citation: Atlas Antibodies Cat# HPA048528, RRID:AB_2680427 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2677666

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CARS2

Proper citation: Atlas Antibodies Cat# HPA041776, RRID:AB_2677666 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684507

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): VWA5B2

Proper citation: Atlas Antibodies Cat# HPA061412, RRID:AB_2684507 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601593

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SRP72

Proper citation: Atlas Antibodies Cat# HPA034621, RRID:AB_10601593 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2677978

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTW; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL22RA1

Proper citation: Atlas Antibodies Cat# HPA042399, RRID:AB_2677978 Copy   


  • RRID:AB_2674403

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2674403

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PRKRA

Proper citation: Atlas Antibodies Cat# HPA034997, RRID:AB_2674403 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686549

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIAA0319L

Proper citation: Atlas Antibodies Cat# HPA072692, RRID:AB_2686549 Copy   


  • RRID:AB_2674092

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2674092

Host Organism: rabbit
Clonality: unknown
Target(s): TSPYL1

Proper citation: Sigma-Aldrich Cat# HPA031970, RRID:AB_2674092 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2678022

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AGAP4

Proper citation: Atlas Antibodies Cat# HPA042490, RRID:AB_2678022 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686099

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GTF3C3

Proper citation: Atlas Antibodies Cat# HPA069179, RRID:AB_2686099 Copy   


  • RRID:AB_2666241

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2666241

Host Organism: rabbit
Clonality: unknown
Target(s): CKAP4

Proper citation: Sigma-Aldrich Cat# HPA001225, RRID:AB_2666241 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X