Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

54,543 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Authority Vendor Catalog Number Record Last Update Mentions Count
Anti-DCP1B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039709, RRID:AB_10672901) DCP1B human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10672901 Antibody Registry Atlas Antibodies HPA039709 2024-07-25 12:31:00 0
Anti-BLMH
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039548, RRID:AB_10805479) BLMH rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10805479 Antibody Registry Atlas Antibodies HPA039548 2024-07-24 10:54:53 0
Anti-SELENOT
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039780, RRID:AB_10805594) SELENOT human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10805594 Antibody Registry Atlas Antibodies HPA039780 2024-07-24 09:17:46 0
Anti-RNF17 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039699, RRID:AB_10795254) RNF17 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795254 Antibody Registry Atlas Antibodies HPA039699 2024-07-25 12:55:12 0
Anti-CCNI polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039853, RRID:AB_2676710) CCNI human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676710 Antibody Registry Atlas Antibodies HPA039853 2024-07-24 05:52:54 0
Anti-RCCD1
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039683, RRID:AB_10794752) RCCD1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10794752 Antibody Registry Atlas Antibodies HPA039683 2024-07-24 09:11:34 0
Anti-ZNF549 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039511, RRID:AB_10671998) ZNF549 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671998 Antibody Registry Atlas Antibodies HPA039511 2024-07-24 09:39:47 0
Anti-UHRF1BP1L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039671, RRID:AB_10794201) UHRF1BP1L human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794201 Antibody Registry Atlas Antibodies HPA039671 2024-07-24 05:19:52 0
Anti-ALKBH7
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039571, RRID:AB_2676577) ALKBH7 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2676577 Antibody Registry Atlas Antibodies HPA039571 2024-07-24 07:06:59 0
Anti-RAB3IL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039723, RRID:AB_10795406) RAB3IL1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795406 Antibody Registry Atlas Antibodies HPA039723 2024-07-24 08:56:02 0
Anti-MAB21L3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039551, RRID:AB_2676565) MAB21L3 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676565 Antibody Registry Atlas Antibodies HPA039551 2024-07-24 11:29:09 0
Anti-EFL1
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039654, RRID:AB_2676610) EFL1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676610 Antibody Registry Atlas Antibodies HPA039654 2024-07-24 10:12:33 0
Anti-SDHAF2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039732, RRID:AB_10962868) SDHAF2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10962868 Antibody Registry Atlas Antibodies HPA039732 2024-07-24 09:07:11 0
Anti-APPL2
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
(Atlas Antibodies Cat# HPA039688, RRID:AB_2676626) APPL2 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2676626 Antibody Registry Atlas Antibodies HPA039688 2024-07-25 12:51:00 1
Anti-BCDIN3D polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039911, RRID:AB_10673021) BCDIN3D human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673021 Antibody Registry Atlas Antibodies HPA039911 2024-07-24 04:17:09 0
Anti-TTC23 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039806, RRID:AB_10793921) TTC23 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10793921 Antibody Registry Atlas Antibodies HPA039806 2024-07-24 08:51:56 0
Anti-NXPE2
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039876, RRID:AB_2676721) NXPE2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2676721 Antibody Registry Atlas Antibodies HPA039876 2024-07-24 11:09:44 0
Anti-PDZRN4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039510, RRID:AB_10674982) PDZRN4 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PPTPPVPDICPFLLSDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSS; Manufacturer approved use: IHC polyclonal rabbit AB_10674982 Antibody Registry Atlas Antibodies HPA039510 2024-07-25 02:42:42 0
Anti-GLB1L3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039916, RRID:AB_2676746) GLB1L3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676746 Antibody Registry Atlas Antibodies HPA039916 2024-07-24 06:27:47 0
Anti-ARL14EP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039634, RRID:AB_2676606) ARL14EP human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676606 Antibody Registry Atlas Antibodies HPA039634 2024-07-24 11:02:02 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.