Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-ARFIP2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038156, RRID:AB_10697243 ARFIP2 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10697243 Atlas Antibodies HPA038156 2025-08-19 04:14:16 0
Anti-CR2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052942, RRID:AB_2681994 CR2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2681994 Atlas Antibodies HPA052942 2025-08-19 04:14:17 0
Anti-NCSTN polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA054846, RRID:AB_2682624 NCSTN human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682624 Atlas Antibodies HPA054846 2025-08-19 04:14:17 0
Anti-REM1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049821, RRID:AB_2680898 REM1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680898 Atlas Antibodies HPA049821 2025-08-19 04:14:16 0
SRSF8-human
 
Resource Report
Resource Website
Rating or validation data
Aviva Systems Biology Cat# ARP40526_T100, RRID:AB_938386 SRSF8 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot QC9683 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615138, AB_938386. unknown rabbit AB_938386 Aviva Systems Biology ARP40526_T100 (also ENCAB000AXI) 2025-08-19 04:14:29 0
Anti-CRYL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040403, RRID:AB_10795632 CRYL1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795632 Atlas Antibodies HPA040403 2025-08-19 04:14:16 0
Anti-ZNF555 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA053956, RRID:AB_2682321 ZNF555 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682321 Atlas Antibodies HPA053956 2025-08-19 04:14:17 0
Anti-BEX5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059058, RRID:AB_2683894 BEX5 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683894 Atlas Antibodies HPA059058 2025-08-19 04:14:17 0
Anti-PLSCR1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA068923, RRID:AB_2686059 PLSCR1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686059 Atlas Antibodies HPA068923 2025-08-19 04:14:17 0
Rabbit anti-ZNF295 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A301-529A, RRID:AB_999694 ZNF295 human Applications: WB, IP
Original Manufacturer
polyclonal rabbit AB_999694 Bethyl A301-529A (also A301-529A-T, A301-529A-M) 2025-08-19 04:14:27 0
Anti-SEMA6C polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA071220, RRID:AB_2686365 SEMA6C human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RSCLASQDPYCGWHSSRGCVDIRGSGGTDVDQAGNQESMEHGDCQDGATGSQSGPGDSAYVLPGPGPSPGTPSPPSDAHPRPQSSTL; Manufacturer approved use: ICC-IF, WB polyclonal rabbit AB_2686365 Atlas Antibodies HPA071220 2025-08-19 04:14:17 0
Anti-SLC25A12
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035334, RRID:AB_2674577 SLC25A12 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2674577 Atlas Antibodies HPA035334 2025-08-19 04:14:44 0
Anti-GLYAT
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044094, RRID:AB_2678807 GLYAT human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2678807 Atlas Antibodies HPA044094 2025-08-19 04:15:02 0
Anti-EDF1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035642, RRID:AB_10611959 EDF1 Human, Rat, Mouse Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10611959 Atlas Antibodies HPA035642 2025-08-19 04:15:02 0
Anti-SAMD15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030677, RRID:AB_10599938 SAMD15 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10599938 Atlas Antibodies HPA030677 2025-08-19 04:14:44 0
Anti-DNAJC10 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031111, RRID:AB_10601211 DNAJC10 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601211 Atlas Antibodies HPA031111 2025-08-19 04:15:02 0
Anti-WDR45 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA027562, RRID:AB_10610565 WDR45 antibody produced in rabbit human polyclonal rabbit AB_10610565 Atlas Antibodies HPA027562 2025-08-19 04:15:06 0
Anti-CHRNA7 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029422, RRID:AB_10600863 CHRNA7 antibody produced in rabbit human polyclonal rabbit AB_10600863 Atlas Antibodies HPA029422 2025-08-19 04:14:47 0
Anti-KANSL3 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA035018, RRID:AB_10601763 KANSL3 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601763 Atlas Antibodies HPA035018 2025-08-19 04:13:28 3
Anti-PHF8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA062015, RRID:AB_2684658 PHF8 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684658 Atlas Antibodies HPA062015 2025-08-19 04:13:13 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.