Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-UBQLN3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA020547, RRID:AB_1858577 UBQLN3 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1858577 Atlas Antibodies HPA020547 2025-08-19 03:56:16 0
Anti-CD300LD polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA027756, RRID:AB_10601097 CD300LD human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH; Manufacturer approved use: IHC polyclonal rabbit AB_10601097 Atlas Antibodies HPA027756 2025-08-19 03:56:04 0
Anti-Matrin 3 antibody [EPR10635(B)]
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Abcam Cat# ab151714, RRID:AB_2491618 Synthetic peptide, corresponding to residues in Human Matrin 3 (UniProt: P43243) EPR10635(B) PMID:24686783 ENCODE Project Validation data monoclonal rabbit AB_2491618 Abcam ab151714 (also ENCAB789SRM) 2025-08-19 03:57:09 3
Anti-DEFB125
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043095, RRID:AB_10795611 DEFB125 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10795611 Atlas Antibodies HPA043095 2025-08-19 03:57:36 0
Anti-IZUMO4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045099, RRID:AB_2679214 IZUMO4 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDTMKELHLAIPAKITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQV; Manufacturer approved use: IHC polyclonal rabbit AB_2679214 Atlas Antibodies HPA045099 2025-08-19 03:57:36 0
Anti-OOSP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050914, RRID:AB_2681271 OOSP2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681271 Atlas Antibodies HPA050914 2025-08-19 03:57:15 0
Anti-TMEM119
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA052650, RRID:AB_2681901 TMEM119 human unknown rabbit AB_2681901 Sigma-Aldrich HPA052650 2025-08-19 03:57:37 0
Anti-CAPNS2 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059749, RRID:AB_2732639 CAPNS2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732639 Atlas Antibodies HPA059749 2025-08-19 03:57:40 0
Anti-PHLDB3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043425, RRID:AB_10797142 PHLDB3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10797142 Atlas Antibodies HPA043425 2025-08-19 03:57:15 0
Anti-BRAT1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA076508, RRID:AB_2686803 BRAT1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686803 Atlas Antibodies HPA076508 2025-08-19 03:57:36 0
Anti-FAM206A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035918, RRID:AB_10670593 FAM206A human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670593 Atlas Antibodies HPA035918 2025-08-19 03:57:35 0
Anti-USP28
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA006779, RRID:AB_1080517 USP28 rat, mouse, human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1080517 Atlas Antibodies HPA006779 2025-08-19 03:57:35 1
Anti-PKIG polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042703, RRID:AB_10797018 PKIG human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10797018 Atlas Antibodies HPA042703 2025-08-19 03:57:15 0
Anti-NPTN polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051497, RRID:AB_2681507 NPTN human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681507 Atlas Antibodies HPA051497 2025-08-19 03:57:36 0
CIP29 Antibody
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A303-209A, RRID:AB_10953169 CIP29 human Discontinued; Applications: IP (2-10 µg/mg lysate) polyclonal rabbit AB_10953169 Thermo Fisher Scientific A303-209A (also A303-209A-T) 2025-08-19 03:57:17 0
KAP-1 Antibody
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A300-275A, RRID:AB_185560 KAP-1 mouse, human Discontinued; Applications: IHC (1:1,000-1:5,000), IP (2-10 µg/mg lysate), WB (1:2,000-1:10,000) polyclonal rabbit AB_185560 Thermo Fisher Scientific A300-275A 2025-08-19 03:57:41 0
Anti-MBL2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA002027, RRID:AB_1079324 MBL2 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot polyclonal rabbit AB_1079324 Sigma-Aldrich HPA002027 2025-08-19 03:58:20 0
Rabbit anti-ZC3H11A Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A301-524A, RRID:AB_999686 ZC3H11A human Applications: WB, IP, IHC
Original Manufacturer
polyclonal rabbit AB_999686 Bethyl A301-524A (also A301-524A-M, A301-524A-T) 2025-08-19 03:58:26 0
Anti-RAB43 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA060085, RRID:AB_2684199 RAB43 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684199 Atlas Antibodies HPA060085 2025-08-19 03:58:23 0
Anti-POU4F3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038215, RRID:AB_10697245 POU4F3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10697245 Atlas Antibodies HPA038215 2025-08-19 03:58:51 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.