Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

54,543 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Authority Vendor Catalog Number Record Last Update Mentions Count
Anti-HDC polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038891, RRID:AB_10673231) HDC human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673231 Antibody Registry Atlas Antibodies HPA038891 2024-07-24 06:14:17 0
Anti-LRRC38 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038778, RRID:AB_10673294) LRRC38 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673294 Antibody Registry Atlas Antibodies HPA038778 2024-07-24 11:24:37 0
Anti-LY6G5C polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038690, RRID:AB_10673286) LY6G5C human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673286 Antibody Registry Atlas Antibodies HPA038690 2024-07-24 06:28:35 0
Anti-MBD6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038948, RRID:AB_2676285) MBD6 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676285 Antibody Registry Atlas Antibodies HPA038948 2024-07-25 03:00:12 0
Anti-GPR63 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039103, RRID:AB_10672841) GPR63 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10672841 Antibody Registry Atlas Antibodies HPA039103 2024-07-24 09:48:56 0
Anti-AKAP11 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039089, RRID:AB_10674279) AKAP11 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10674279 Antibody Registry Atlas Antibodies HPA039089 2024-07-25 02:36:48 0
Anti-TTC36 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038731, RRID:AB_10672651) TTC36 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10672651 Antibody Registry Atlas Antibodies HPA038731 2024-07-24 05:07:46 0
Anti-RNF44 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038981, RRID:AB_10674846) RNF44 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10674846 Antibody Registry Atlas Antibodies HPA038981 2024-07-24 04:49:17 0
Anti-GTSF1
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038877, RRID:AB_2676251) GTSF1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2676251 Antibody Registry Atlas Antibodies HPA038877 2024-07-24 06:50:11 0
Anti-TRPT1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038706, RRID:AB_10671863) TRPT1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671863 Antibody Registry Atlas Antibodies HPA038706 2024-07-24 09:47:40 0
Anti-PPHLN1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
(Atlas Antibodies Cat# HPA038902, RRID:AB_10674844) PPHLN1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10674844 Antibody Registry Atlas Antibodies HPA038902 2024-07-24 06:23:10 1
Anti-MBD6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038949, RRID:AB_10671868) MBD6 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671868 Antibody Registry Atlas Antibodies HPA038949 2024-07-25 02:40:05 0
Anti-C14orf80 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039050, RRID:AB_10670918) C14orf80 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670918 Antibody Registry Atlas Antibodies HPA039050 2024-07-25 12:51:44 0
Anti-CD7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039079, RRID:AB_2676337) CD7 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676337 Antibody Registry Atlas Antibodies HPA039079 2024-07-24 04:17:09 0
Anti-SPG20 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039054, RRID:AB_2676323) SPG20 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676323 Antibody Registry Atlas Antibodies HPA039054 2024-07-24 06:18:48 0
Anti-DNAH10 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039065, RRID:AB_2676329) DNAH10 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNEL; Manufacturer approved use: IHC polyclonal rabbit AB_2676329 Antibody Registry Atlas Antibodies HPA039065 2024-07-25 01:58:11 0
Anti-PACS1
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038914, RRID:AB_10672831) PACS1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10672831 Antibody Registry Atlas Antibodies HPA038914 2024-07-24 06:54:46 0
Anti-MAP6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039062, RRID:AB_2676326) MAP6 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676326 Antibody Registry Atlas Antibodies HPA039062 2024-07-25 03:20:47 0
Anti-TCAF2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038758, RRID:AB_10960353) TCAF2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10960353 Antibody Registry Atlas Antibodies HPA038758 2024-07-24 11:08:25 0
Anti-PIGQ polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039105, RRID:AB_10796221) PIGQ human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10796221 Antibody Registry Atlas Antibodies HPA039105 2024-07-25 12:07:05 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.