Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10805708
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): STAMBPL1
Proper citation: Atlas Antibodies Cat# HPA040202, RRID:AB_10805708 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2668972
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): FAM210A
Proper citation: Atlas Antibodies Cat# HPA014324, RRID:AB_2668972 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675855
Host Organism: rabbit
Clonality: unknown
Target(s): PLCD4
Proper citation: Sigma-Aldrich Cat# HPA038139, RRID:AB_2675855 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673630
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NUDCD2
Proper citation: Atlas Antibodies Cat# HPA037385, RRID:AB_10673630 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858189
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TOP2A
Proper citation: Atlas Antibodies Cat# HPA006458, RRID:AB_1858189 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10695312
Comments: Applications: W, IP, IHC-P, IHC-F, ChIP. Consolidation on 11/2018: AB_10695312, AB_10827874, AB_490892.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Clonality: unknown
Target(s): beta-Catenin
Proper citation: Cell Signaling Technology Cat# 9587, RRID:AB_10695312 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602029
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Western Blot; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): MRPS18A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA035451, RRID:AB_10602029 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846529
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ADAP1
Proper citation: Atlas Antibodies Cat# HPA007033, RRID:AB_1846529 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10602321
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GGCT
Proper citation: Atlas Antibodies Cat# HPA029914, RRID:AB_10602321 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959734
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM217B
Proper citation: Atlas Antibodies Cat# HPA041021, RRID:AB_10959734 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846276
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IGF2R
Proper citation: Atlas Antibodies Cat# HPA011332, RRID:AB_1846276 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683319
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PIGK
Proper citation: Atlas Antibodies Cat# HPA057040, RRID:AB_2683319 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682083
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM177A1
Proper citation: Atlas Antibodies Cat# HPA053222, RRID:AB_2682083 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079536
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence WWSKYFASIDTMKEQLRQQEPSGIDLEEKEEVDNTEGLKGSMKGKEKARAAKEEKKKKTQSSGSGQGSEAPEKKKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDE; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): OTOF
Proper citation: Atlas Antibodies Cat# HPA007502, RRID:AB_1079536 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847689
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): FAM198B
Proper citation: Atlas Antibodies Cat# HPA007227, RRID:AB_1847689 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2669380
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): WNK2
Proper citation: Atlas Antibodies Cat# HPA016519, RRID:AB_2669380 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845570
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM161B
Proper citation: Atlas Antibodies Cat# HPA019125, RRID:AB_1845570 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849478
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GARS
Proper citation: Atlas Antibodies Cat# HPA017896, RRID:AB_1849478 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848588
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FBN2
Proper citation: Atlas Antibodies Cat# HPA012853, RRID:AB_1848588 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854073
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MPDZ
Proper citation: Atlas Antibodies Cat# HPA020255, RRID:AB_1854073 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.