SYSTEM UPDATE: We will be performing system maintenace Saturday September 26 at 9pm to midnight Pacific Time

Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

54,544 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Authority Vendor Catalog Number Record Last Update Mentions Count
Anti-CFAP46 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038868, RRID:AB_2676247) CFAP46 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676247 Antibody Registry Atlas Antibodies HPA038868 2024-07-24 09:56:53 0
Anti-NBPF11 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038748, RRID:AB_2676188) NBPF11 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676188 Antibody Registry Atlas Antibodies HPA038748 2024-07-25 12:41:35 0
Anti-RITA1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039094, RRID:AB_10671037) RITA1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671037 Antibody Registry Atlas Antibodies HPA039094 2024-07-25 03:17:08 0
Anti-LRRC56 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038728, RRID:AB_10671864) LRRC56 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671864 Antibody Registry Atlas Antibodies HPA038728 2024-07-24 10:34:58 0
Anti-MAP1A
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039064, RRID:AB_10673302) MAP1A human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10673302 Antibody Registry Atlas Antibodies HPA039064 2024-07-25 01:51:38 0
Anti-CHCHD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039046, RRID:AB_10673234) CHCHD1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673234 Antibody Registry Atlas Antibodies HPA039046 2024-07-24 08:56:01 0
Anti-BCAS4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038812, RRID:AB_10795141) BCAS4 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795141 Antibody Registry Atlas Antibodies HPA038812 2024-07-24 10:34:53 0
Anti-TRIM55 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038793, RRID:AB_10673289) TRIM55 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673289 Antibody Registry Atlas Antibodies HPA038793 2024-07-24 06:42:00 0
Anti-CFHR1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038915, RRID:AB_2676269) CFHR1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676269 Antibody Registry Atlas Antibodies HPA038915 2024-07-24 08:39:36 0
Anti-C11orf80 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038933, RRID:AB_10671867) C11orf80 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671867 Antibody Registry Atlas Antibodies HPA038933 2024-07-25 01:31:30 0
Anti-MAP1A
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039063, RRID:AB_2676327) MAP1A human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2676327 Antibody Registry Atlas Antibodies HPA039063 2024-07-24 06:39:22 0
Anti-FBXW8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038850, RRID:AB_2676238) FBXW8 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676238 Antibody Registry Atlas Antibodies HPA038850 2024-07-25 02:40:05 0
Anti-LUZP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039007, RRID:AB_2676307) LUZP2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676307 Antibody Registry Atlas Antibodies HPA039007 2024-07-24 05:36:18 0
Anti-CFAP46 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038867, RRID:AB_2676246) CFAP46 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676246 Antibody Registry Atlas Antibodies HPA038867 2024-07-24 04:55:58 0
Anti-RUFY1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038804, RRID:AB_10673290) RUFY1 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673290 Antibody Registry Atlas Antibodies HPA038804 2024-07-24 07:02:09 0
Anti-ODF3
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038919, RRID:AB_2676270) ODF3 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2676270 Antibody Registry Atlas Antibodies HPA038919 2024-07-24 06:55:20 0
Anti-PPP1R32 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA039067, RRID:AB_2676331) PPP1R32 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PYVKMSSGGYTDPLKFYATSYCTAYGREDFKPRVGSHVGTGYKSNFQPVVSCQASLEALDNPARGEQAQDHFQSVASQSYRPLEVPDGKH; Manufacturer approved use: IHC polyclonal rabbit AB_2676331 Antibody Registry Atlas Antibodies HPA039067 2024-07-25 02:23:58 0
Anti-ADRA1D polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038789, RRID:AB_10673475) ADRA1D human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673475 Antibody Registry Atlas Antibodies HPA038789 2024-07-24 08:12:09 0
Anti-ALPP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038764, RRID:AB_2676194) ALPP human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676194 Antibody Registry Atlas Antibodies HPA038764 2024-07-25 01:21:09 0
Anti-SEC24A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
(Atlas Antibodies Cat# HPA038901, RRID:AB_10674843) SEC24A human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10674843 Antibody Registry Atlas Antibodies HPA038901 2024-07-24 07:54:09 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.