Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-ABHD6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA073225, RRID:AB_2686583 ABHD6 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686583 Atlas Antibodies HPA073225 2025-08-19 05:06:16 0
Anti-DHX8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049285, RRID:AB_2680698 DHX8 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680698 Atlas Antibodies HPA049285 2025-08-19 05:06:15 0
Anti-HES3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA047927, RRID:AB_2680213 HES3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RARINVSLEQLKSLLEKHYSHQIRKRKLEKAD; Manufacturer approved use: IHC polyclonal rabbit AB_2680213 Atlas Antibodies HPA047927 2025-08-19 05:06:15 0
Anti-IGBP1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001004, RRID:AB_1079104 IGBP1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079104 Atlas Antibodies HPA001004 2025-08-19 05:06:14 0
Anti-ZNF575 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051865, RRID:AB_2681643 ZNF575 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681643 Atlas Antibodies HPA051865 2025-08-19 05:06:15 0
Anti-FADS3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045224, RRID:AB_10967570 FADS3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10967570 Atlas Antibodies HPA045224 2025-08-19 05:06:14 0
Anti-HIPK2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA007611, RRID:AB_1850730 HIPK2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1850730 Atlas Antibodies HPA007611 2025-08-19 05:06:14 0
Anti-ANKRD54 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA071287, RRID:AB_2686380 ANKRD54 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686380 Atlas Antibodies HPA071287 2025-08-19 05:06:16 0
Anti-MICU1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA037479, RRID:AB_2675495 MICU1 human unknown rabbit AB_2675495 Sigma-Aldrich HPA037479 2025-08-19 05:06:16 4
Anti-NDUFA9
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA042268, RRID:AB_2677922 NDUFA9 human unknown rabbit AB_2677922 Sigma-Aldrich HPA042268 2025-08-19 05:06:17 0
Anti-NMRAL1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041353, RRID:AB_10796343 NMRAL1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10796343 Atlas Antibodies HPA041353 2025-08-19 05:07:38 0
Rabbit anti-MAP4 Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A301-489A, RRID:AB_999616 MAP4 human Applications: WB, IP, IHC polyclonal rabbit AB_999616 Bethyl A301-489A (also A301-489A-M, A301-489A-T) 2025-08-19 05:08:15 2
Anti-COL18A1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA011025, RRID:AB_1078551 COL18A1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078551 Atlas Antibodies HPA011025 2025-08-19 05:08:17 0
Anti-EVI5L polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043563, RRID:AB_2678556 EVI5L human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678556 Atlas Antibodies HPA043563 2025-08-19 05:08:17 0
Anti-PAPLN polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA048682, RRID:AB_2680492 PAPLN human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680492 Atlas Antibodies HPA048682 2025-08-19 05:08:17 0
Anti-THAP8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA064056, RRID:AB_2685184 THAP8 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685184 Atlas Antibodies HPA064056 2025-08-19 05:07:39 0
Anti-NPB polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA057419, RRID:AB_2683433 NPB human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLR; Manufacturer approved use: IHC polyclonal rabbit AB_2683433 Atlas Antibodies HPA057419 2025-08-19 05:08:17 0
Anti-HEY2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA074851, RRID:AB_2686718 HEY2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686718 Atlas Antibodies HPA074851 2025-08-19 05:08:17 0
Anti-C16orf72 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA067492, RRID:AB_2685850 C16orf72 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685850 Atlas Antibodies HPA067492 2025-08-19 05:07:39 0
Anti-PRR16 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049254, RRID:AB_2680693 PRR16 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680693 Atlas Antibodies HPA049254 2025-08-19 05:07:38 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.