Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685640
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPG; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): BCOR
Proper citation: Atlas Antibodies Cat# HPA066234, RRID:AB_2685640 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677115
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ESRP2
Proper citation: Atlas Antibodies Cat# HPA040751, RRID:AB_2677115 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680544
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GNA11
Proper citation: Atlas Antibodies Cat# HPA048886, RRID:AB_2680544 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601672
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RAB11FIP3
Proper citation: Atlas Antibodies Cat# HPA028088, RRID:AB_10601672 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680533
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CIB1
Proper citation: Atlas Antibodies Cat# HPA048825, RRID:AB_2680533 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676456
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RNF6
Proper citation: Atlas Antibodies Cat# HPA039343, RRID:AB_2676456 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_493175
Comments: Applications: FC, SB
Host Organism: mouse
Clonality: monoclonal
Target(s): HLA-DR
Proper citation: BioLegend Cat# 307620, RRID:AB_493175 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078115
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): AIP antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA004063, RRID:AB_1078115 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849933
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPM6A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA017338, RRID:AB_1849933 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849151
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): FRMPD2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA018872, RRID:AB_1849151 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858432
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): AC091172.1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023862, RRID:AB_1858432 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849530
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GBA2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024026, RRID:AB_1849530 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600878
Comments: Vendor recommendations: Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): EIF3I antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029940, RRID:AB_10600878 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611252
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GLT25D2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031750, RRID:AB_10611252 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673036
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): AGBL4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037994, RRID:AB_10673036 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670779
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): SYNGAP1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA038373, RRID:AB_10670779 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670967
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): AGA antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031417, RRID:AB_10670967 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732494
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): TBC1D2B
Proper citation: Atlas Antibodies Cat# HPA041833, RRID:AB_2732494 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855139
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PDK1
Proper citation: Atlas Antibodies Cat# HPA027376, RRID:AB_1855139 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685569
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MFSD1
Proper citation: Atlas Antibodies Cat# HPA065858, RRID:AB_2685569 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.