Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 321 showing 6401 ~ 6420 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681774

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): LRRC24

Proper citation: Atlas Antibodies Cat# HPA052250, RRID:AB_2681774 Copy   


Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_631276

Comments: Discontinued: 2016; Discontinued: 2016; Rabbit polyclonal affinity purified to amino acids 1-262 of c-Myc human origin. Antibody Target: MYC
Validation: ENCODE PROJECT validation information available
Host Organism: rabbit
Clonality polyclonal
Target(s): MYC

Proper citation: Santa Cruz Biotechnology Cat# sc-764, RRID:AB_631276 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2241631

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSREFRGHRNCVLTLAYSAPWDLPSTPCAEEAAAGGLLVTGSTDGTAKVWQVASGCCHQTLRGHTGAVLCLVLDTPGHTAFTGSTDATIRAWDILSG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): WDR86

Proper citation: Atlas Antibodies Cat# HPA021086, RRID:AB_2241631 Copy   


  • RRID:AB_11170543

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_11170543

Comments: Discontinued; ENCODE PROJECT External validation DATA SET is released testing lot 821400555 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality polyclonal
Target(s): FOXA3

Proper citation: GeneTex Cat# GTX79266, RRID:AB_11170543 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079365

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): MFAP2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA007354, RRID:AB_1079365 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1850766

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human C17orf80

Proper citation: Sigma-Aldrich Cat# HPA012896, RRID:AB_1850766 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857536

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human STAB2

Proper citation: Sigma-Aldrich Cat# HPA026871, RRID:AB_1857536 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1856431

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human RPL10

Proper citation: Sigma-Aldrich Cat# HPA011311, RRID:AB_1856431 Copy   


  • RRID:AB_1850591

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1850591

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): HEMGN

Proper citation: Atlas Antibodies Cat# HPA019606, RRID:AB_1850591 Copy   


  • RRID:AB_1950992

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1950992

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 39946 for K562; status is eligible for new data (via exemption)
Host Organism: rabbit
Clonality polyclonal
Target(s): NFE2

Proper citation: GeneTex Cat# GTX102698, RRID:AB_1950992 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858063

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human TMED1

Proper citation: Sigma-Aldrich Cat# HPA018507, RRID:AB_1858063 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2256120

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): TMEM176A

Proper citation: Sigma-Aldrich Cat# HPA008770, RRID:AB_2256120 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10793923

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): PTPRU antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA039832, RRID:AB_10793923 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794530

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): ASPDH antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA042631, RRID:AB_10794530 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859548

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): AP000347.1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA018938, RRID:AB_1859548 Copy   


  • RRID:AB_10953539

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10953539

Comments: Discontinued: 2021; Original Manufacturer; Applications: IP
Host Organism: rabbit
Clonality unknown
Target(s): ZNF518A

Proper citation: Bethyl Cat# A303-237A, RRID:AB_10953539 Copy   


  • RRID:AB_1240455

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1240455

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 39476 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): ANXA2

Proper citation: GeneTex Cat# GTX100046, RRID:AB_1240455 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854581

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): NPC1L1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA018105, RRID:AB_1854581 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1851489

Comments: Vendor recommendations: Immunofluorescence; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Western Blot; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): IGFBP3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA013357, RRID:AB_1851489 Copy   


  • RRID:AB_2193048

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2193048

Comments: validation status unknown check with seller; recommendations: WB, IP, IF, ELISA; Western Blot; Immunofluorescence; Immunoprecipitation; ELISA
Host Organism: mouse
Clonality monoclonal
Target(s): Smad2/3 (C-8)

Proper citation: Santa Cruz Biotechnology Cat# sc-133098, RRID:AB_2193048 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X