Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-GMFB antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA002954, RRID:AB_1078997 GMFB antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1078997 Sigma-Aldrich HPA002954 2025-08-19 04:59:42 1
Parathormone
 
Resource Report
Resource Website
Rating or validation data
New York University; New York; USA Cat# PL0009, RRID:AB_2335813 ND ND Used By NYUIHC-265
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal AB_2335813 New York University; New York; USA PL0009 2025-08-19 04:59:50 0
Anti-TPPP
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036576, RRID:AB_2675200 TPPP human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2675200 Atlas Antibodies HPA036576 2025-08-19 05:00:10 0
Rabbit anti-RBM16 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A301-036A, RRID:AB_817964 RBM16 mouse, human Applications: WB, IP polyclonal rabbit AB_817964 Bethyl A301-036A (also A301-036A-M, A301-036A-T) 2025-08-19 05:00:02 0
Anti-BCL7B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049943, RRID:AB_2680963 BCL7B human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680963 Atlas Antibodies HPA049943 2025-08-19 05:00:04 0
Rabbit anti-ZNF318/TZF Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A301-545A, RRID:AB_1040021 ZNF318/TZF human Applications: IP polyclonal rabbit AB_1040021 Bethyl A301-545A (also A301-545A-T) 2025-08-19 05:00:08 0
Rabbit anti-RBM22 Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A303-923A, RRID:AB_2620272 RBM22 mouse, human Applications: WB, IP polyclonal rabbit AB_2620272 Bethyl A303-923A (also A303-923A-M, A303-923A-T) 2025-08-19 05:00:08 1
Anti-PSD4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA034723, RRID:AB_2674299 PSD4 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2674299 Atlas Antibodies HPA034723 2025-08-19 05:00:10 0
Anti-CPEB3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059056, RRID:AB_2683893 CPEB3 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683893 Atlas Antibodies HPA059056 2025-08-19 05:00:05 0
Anti-MAP1LC3A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043000, RRID:AB_2678264 MAP1LC3A human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2678264 Atlas Antibodies HPA043000 2025-08-19 05:00:04 0
Anti-USP54 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA047663, RRID:AB_2680116 USP54 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680116 Atlas Antibodies HPA047663 2025-08-19 05:00:10 0
Anti-NEO1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA027805, RRID:AB_10601755 NEO1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601755 Atlas Antibodies HPA027805 2025-08-19 05:00:04 0
Anti-NOTCH1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA067168, RRID:AB_2685795 NOTCH1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685795 Atlas Antibodies HPA067168 2025-08-19 05:00:05 2
Anti-GABRA6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA058329, RRID:AB_2683680 GABRA6 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GKLEVEGNFYSENVSRILDNLLEG; Manufacturer approved use: IHC polyclonal rabbit AB_2683680 Atlas Antibodies HPA058329 2025-08-19 05:00:10 0
Anti-GUF1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003934, RRID:AB_1079034 GUF1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079034 Atlas Antibodies HPA003934 2025-08-19 05:00:04 0
Anti-MRPS14 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051087, RRID:AB_2681339 MRPS14 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681339 Atlas Antibodies HPA051087 2025-08-19 05:00:04 0
POLDIP3-human
 
Resource Report
Resource Website
Rating or validation data
GeneTex Cat# GTX122304, RRID:AB_11167581 POLDIP3 human ENCODE PROJECT External validation DATA SET is released testing lot 40569 for not specified; status is not pursued polyclonal rabbit AB_11167581 GeneTex GTX122304 2025-08-19 05:00:07 0
Anti-TFAM
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA040648, RRID:AB_10795635 TFAM human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10795635 Atlas Antibodies HPA040648 2025-08-19 05:00:04 1
Anti-ADAR
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051519, RRID:AB_2681520 ADAR human Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2681520 Atlas Antibodies HPA051519 2025-08-19 05:00:10 0
Anti-NFIX polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA007533, RRID:AB_2667855 NFIX human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2667855 Atlas Antibodies HPA007533 2025-08-19 05:00:04 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.