Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683705
Comments:
Host Organism: rabbit
Clonality unknown
Target(s): SNTN
Proper citation: Sigma-Aldrich Cat# HPA058399, RRID:AB_2683705 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683801
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RBM19
Proper citation: Atlas Antibodies Cat# HPA058732, RRID:AB_2683801 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847088
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): COL1A1
Proper citation: Atlas Antibodies Cat# HPA011795, RRID:AB_1847088 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795269
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PTPN9
Proper citation: Atlas Antibodies Cat# HPA041922, RRID:AB_10795269 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682497
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PAPD4
Proper citation: Atlas Antibodies Cat# HPA054468, RRID:AB_2682497 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679067
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): DCAF12L2
Proper citation: Atlas Antibodies Cat# HPA044737, RRID:AB_2679067 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794865
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): ZC3H18
Proper citation: Atlas Antibodies Cat# HPA040847, RRID:AB_10794865 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671102
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): PARD3B
Proper citation: Atlas Antibodies Cat# HPA035283, RRID:AB_10671102 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616378
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality unknown
Target(s): ash1
Proper citation: SDIX Cat# 5010.00.02, RRID:AB_2616378 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849474
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RAP1GAP2
Proper citation: Atlas Antibodies Cat# HPA022148, RRID:AB_1849474 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683796
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): HNRNPU
Proper citation: Atlas Antibodies Cat# HPA058707, RRID:AB_2683796 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680974
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CCNJL
Proper citation: Atlas Antibodies Cat# HPA049970, RRID:AB_2680974 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678585
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): RALGAPA2
Proper citation: Atlas Antibodies Cat# HPA043622, RRID:AB_2678585 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601655
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): GNL2
Proper citation: Atlas Antibodies Cat# HPA027163, RRID:AB_10601655 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679650
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSR; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality polyclonal
Target(s): NOTCH2NL
Proper citation: Atlas Antibodies Cat# HPA046392, RRID:AB_2679650 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681801
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): AKNA
Proper citation: Atlas Antibodies Cat# HPA052367, RRID:AB_2681801 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670386
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): PSMA1
Proper citation: Atlas Antibodies Cat# HPA037646, RRID:AB_10670386 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603561
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality unknown
Target(s): COX5B
Proper citation: Atlas Antibodies Cat# HPA034517, RRID:AB_10603561 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10669665
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): FGF19
Proper citation: Atlas Antibodies Cat# HPA036082, RRID:AB_10669665 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_999695
Comments: Applications: IP, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF592
Proper citation: Bethyl Cat# A301-531A, RRID:AB_999695 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
