Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-WDR86 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA021086, RRID:AB_2241631 | WDR86 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSREFRGHRNCVLTLAYSAPWDLPSTPCAEEAAAGGLLVTGSTDGTAKVWQVASGCCHQTLRGHTGAVLCLVLDTPGHTAFTGSTDATIRAWDILSG; Manufacturer approved use: IHC | polyclonal | rabbit | AB_2241631 | Atlas Antibodies | HPA021086 | 2025-08-19 05:10:42 | 0 | ||
|
Anti-NEU1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA015634, RRID:AB_1854386 | NEU1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_1854386 | Sigma-Aldrich | HPA015634 | 2025-08-19 05:10:53 | 0 | ||
|
Anti-DPF2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA020880, RRID:AB_1847845 | Human DPF2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847845 | Sigma-Aldrich | HPA020880 | 2025-08-19 05:10:58 | 0 | ||
|
Anti-EGFR antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA018530, RRID:AB_1848044 | Human EGFR | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1848044 | Sigma-Aldrich | HPA018530 | 2025-08-19 05:11:20 | 3 | ||
|
MTA2 (H-170) Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-28731, RRID:AB_2266707 | MTA2 (H-170) | rat, mouse, human | Discontinued: 2016; validation status unknown check with seller; recommendations: Immunoprecipitation; WB, IP, IF, ELISA; Western Blot; ELISA; Immunofluorescence | polyclonal | rabbit | AB_2266707 | Santa Cruz Biotechnology | sc-28731 | 2025-08-19 05:11:24 | 1 | ||
|
Anti-GMPR2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA000904, RRID:AB_1078998 | GMPR2 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1078998 | Sigma-Aldrich | HPA000904 | 2025-08-19 05:11:28 | 0 | ||
|
Anti-BCAR3 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA014858, RRID:AB_1845302 | Human BCAR3 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1845302 | Sigma-Aldrich | HPA014858 | 2025-08-19 05:11:26 | 0 | ||
|
RPN1-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX101888, RRID:AB_1951761 | RPN1 | human | ENCODE PROJECT External validation DATA SET is released testing lot 39631 for not specified; status is not pursued | polyclonal | rabbit | AB_1951761 | GeneTex | GTX101888 | 2025-08-19 05:11:33 | 0 | ||
|
Anti-AUH Resource Report Resource Website Rating or validation data |
MBL International Cat# RN037P, RRID:AB_10606343 | AUH | rat, h, m, mouse, r, human | manufacturer recommendations: Immunoprecipitation; Radioimmunoassay; Western Blot; WB, IPP, RIP | unknown | rabbit | AB_10606343 | MBL International | RN037P | 2025-08-19 05:11:30 | 0 | ||
|
Anti-ATP1B4 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044128, RRID:AB_10961994 | ATP1B4 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10961994 | Sigma-Aldrich | HPA044128 | 2025-08-19 05:11:12 | 0 | |||
|
Anti-COL1A1 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA011795, RRID:AB_1847088 | COL1A1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1847088 | Sigma-Aldrich | HPA011795 | 2025-08-19 05:11:32 | 4 | ||
|
Anti-SOX8 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA041640, RRID:AB_10964357 | SOX8 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10964357 | Sigma-Aldrich | HPA041640 | 2025-08-19 05:11:12 | 0 | |||
|
Anti-TSKS antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA045729, RRID:AB_10963430 | TSKS antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10963430 | Sigma-Aldrich | HPA045729 | 2025-08-19 05:11:30 | 0 | |||
|
Anti-NOVA2 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA045607, RRID:AB_10962628 | NOVA2 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10962628 | Sigma-Aldrich | HPA045607 | 2025-08-19 05:11:12 | 1 | |||
|
Anti-SNX16 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA024731, RRID:AB_1857346 | SNX16 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_1857346 | Sigma-Aldrich | HPA024731 | 2025-08-19 05:03:28 | 0 | ||
|
Prealbumin (Transthyretin) Resource Report Resource Website 1+ mentions Rating or validation data |
Agilent Cat# A0002, RRID:AB_2335696 | Prealbumin isolated from human plasma. |
Used By NYUIHC-1311. Original Manufacturer: Dako. Now part of Agilent. Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
polyclonal | rabbit | AB_2335696 | Agilent | A0002 | 2025-08-19 05:03:29 | 6 | |||
|
Anti-MPST antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA001240, RRID:AB_1079408 | MPST antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1079408 | Sigma-Aldrich | HPA001240 | 2025-08-19 05:03:31 | 3 | ||
|
Anti-PDE7B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA023967, RRID:AB_1855128 | PDE7B antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1855128 | Sigma-Aldrich | HPA023967 | 2025-08-19 05:03:31 | 0 | ||
|
Human Tie-2 Antibody Resource Report Resource Website 1+ mentions Rating or validation data |
R and D Systems Cat# AF313, RRID:AB_355295 | Tie-2 | Human | Applications: Western Blot, Simple Western, Immunohistochemistry, Blockade of Receptor-ligand Interaction | polyclonal | Goat | AB_355295 | R and D Systems | AF313 (also AF313-SP) | 2025-08-19 05:03:36 | 2 | ||
|
Anti-NDUFS2 Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA061953, RRID:AB_2684646 | NDUFS2 | human | unknown | rabbit | AB_2684646 | Sigma-Aldrich | HPA061953 | 2025-08-19 05:04:08 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web. We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.
