Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 313 showing 6241 ~ 6260 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2241631

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSREFRGHRNCVLTLAYSAPWDLPSTPCAEEAAAGGLLVTGSTDGTAKVWQVASGCCHQTLRGHTGAVLCLVLDTPGHTAFTGSTDATIRAWDILSG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): WDR86

Proper citation: Atlas Antibodies Cat# HPA021086, RRID:AB_2241631 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854386

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality polyclonal
Target(s): NEU1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA015634, RRID:AB_1854386 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847845

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human DPF2

Proper citation: Sigma-Aldrich Cat# HPA020880, RRID:AB_1847845 Copy   


  • RRID:AB_1848044

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848044

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human EGFR

Proper citation: Sigma-Aldrich Cat# HPA018530, RRID:AB_1848044 Copy   


  • RRID:AB_2266707

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2266707

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: Immunoprecipitation; WB, IP, IF, ELISA; Western Blot; ELISA; Immunofluorescence
Host Organism: rabbit
Clonality polyclonal
Target(s): MTA2 (H-170)

Proper citation: Santa Cruz Biotechnology Cat# sc-28731, RRID:AB_2266707 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078998

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): GMPR2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA000904, RRID:AB_1078998 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845302

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality unknown
Target(s): Human BCAR3

Proper citation: Sigma-Aldrich Cat# HPA014858, RRID:AB_1845302 Copy   


  • RRID:AB_1951761

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1951761

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 39631 for not specified; status is not pursued
Host Organism: rabbit
Clonality polyclonal
Target(s): RPN1

Proper citation: GeneTex Cat# GTX101888, RRID:AB_1951761 Copy   


  • RRID:AB_10606343

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10606343

Comments: manufacturer recommendations: Immunoprecipitation; Radioimmunoassay; Western Blot; WB, IPP, RIP
Host Organism: rabbit
Clonality unknown
Target(s): AUH

Proper citation: MBL International Cat# RN037P, RRID:AB_10606343 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10961994

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): ATP1B4 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA044128, RRID:AB_10961994 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847088

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): COL1A1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA011795, RRID:AB_1847088 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964357

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): SOX8 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA041640, RRID:AB_10964357 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10963430

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism:
Clonality polyclonal
Target(s): TSKS antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045729, RRID:AB_10963430 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10962628

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Host Organism:
Clonality polyclonal
Target(s): NOVA2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045607, RRID:AB_10962628 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857346

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality polyclonal
Target(s): SNX16 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA024731, RRID:AB_1857346 Copy   


  • RRID:AB_2335696

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2335696

Comments: Used By NYUIHC-1311. Original Manufacturer: Dako. Now part of Agilent.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality polyclonal
Target(s): Prealbumin isolated from human plasma.

Proper citation: Agilent Cat# A0002, RRID:AB_2335696 Copy   


  • RRID:AB_1079408

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079408

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): MPST antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA001240, RRID:AB_1079408 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855128

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality polyclonal
Target(s): PDE7B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA023967, RRID:AB_1855128 Copy   


  • RRID:AB_355295

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_355295

Comments: Applications: Western Blot, Simple Western, Immunohistochemistry, Blockade of Receptor-ligand Interaction
Host Organism: Goat
Clonality polyclonal
Target(s): Tie-2

Proper citation: R and D Systems Cat# AF313, RRID:AB_355295 Copy   


  • RRID:AB_2684646

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684646

Comments:
Host Organism: rabbit
Clonality unknown
Target(s): NDUFS2

Proper citation: Sigma-Aldrich Cat# HPA061953, RRID:AB_2684646 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X