Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 313 showing 6241 ~ 6260 out of 56,320 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686726

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HS2ST1

Proper citation: Atlas Antibodies Cat# HPA075001, RRID:AB_2686726 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686846

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RPL36A

Proper citation: Atlas Antibodies Cat# HPA077586, RRID:AB_2686846 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686841

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PAPPKAEAKAKALKAKKAVLKGVHSHKKKKIRTSPTF; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): RPL23A

Proper citation: Atlas Antibodies Cat# HPA077474, RRID:AB_2686841 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686657

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZBTB47

Proper citation: Atlas Antibodies Cat# HPA074057, RRID:AB_2686657 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686760

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MT-ND4L

Proper citation: Atlas Antibodies Cat# HPA075648, RRID:AB_2686760 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686813

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PAQR5

Proper citation: Atlas Antibodies Cat# HPA076729, RRID:AB_2686813 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686775

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PDE4A

Proper citation: Atlas Antibodies Cat# HPA076091, RRID:AB_2686775 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686795

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LILLSSLVQQDSQVHTWGCLFSTFTST; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM99

Proper citation: Atlas Antibodies Cat# HPA076359, RRID:AB_2686795 Copy   

    • RRID:AB_2686752

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686752

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CIT

Proper citation: Atlas Antibodies Cat# HPA075506, RRID:AB_2686752 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686672

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): METTL22

Proper citation: Atlas Antibodies Cat# HPA074173, RRID:AB_2686672 Copy   

    • RRID:AB_2686682

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686682

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LETMD1

Proper citation: Atlas Antibodies Cat# HPA074361, RRID:AB_2686682 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686826

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SYNE3

Proper citation: Atlas Antibodies Cat# HPA077140, RRID:AB_2686826 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686816

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC6A16

Proper citation: Atlas Antibodies Cat# HPA076812, RRID:AB_2686816 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686867

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM76A

Proper citation: Atlas Antibodies Cat# HPA077897, RRID:AB_2686867 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686848

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LREAEIEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCVEDLRSRL; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFRSF25

Proper citation: Atlas Antibodies Cat# HPA077620, RRID:AB_2686848 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686857

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KRT80

Proper citation: Atlas Antibodies Cat# HPA077836, RRID:AB_2686857 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686656

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SOX15

Proper citation: Atlas Antibodies Cat# HPA074049, RRID:AB_2686656 Copy   

    • RRID:AB_2686727

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686727

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SOX3

Proper citation: Atlas Antibodies Cat# HPA075003, RRID:AB_2686727 Copy   

    • RRID:AB_2686666

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686666

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TSC1

Proper citation: Atlas Antibodies Cat# HPA074132, RRID:AB_2686666 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686883

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SMKR1

Proper citation: Atlas Antibodies Cat# HPA078358, RRID:AB_2686883 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

Welcome to the Neuroscience Information Framework Project, designed to serve the biomedical research community. NIF maintains the largest searchable collection of neuroscience data, the largest catalog of biomedical resources, and the largest ontology for neuroscience on the web.  We welcome all feedback and suggestions and are actively looking for resource providers to make their resources accessible through NIF. Learn about the tools available to help you share your data and discover a dynamic inventory of Web-based neuroscience resources.

Recent News Entries

Recommendations for repositories and scientific gateways from a neuroscience perspective

NEURON course at the CNS meeting

Neuron Course this year has just been announced!

Contact Us

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch