Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2241631
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSREFRGHRNCVLTLAYSAPWDLPSTPCAEEAAAGGLLVTGSTDGTAKVWQVASGCCHQTLRGHTGAVLCLVLDTPGHTAFTGSTDATIRAWDILSG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): WDR86
Proper citation: Atlas Antibodies Cat# HPA021086, RRID:AB_2241631 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854386
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): NEU1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015634, RRID:AB_1854386 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847845
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human DPF2
Proper citation: Sigma-Aldrich Cat# HPA020880, RRID:AB_1847845 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1848044
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human EGFR
Proper citation: Sigma-Aldrich Cat# HPA018530, RRID:AB_1848044 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2266707
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: Immunoprecipitation; WB, IP, IF, ELISA; Western Blot; ELISA; Immunofluorescence
Host Organism: rabbit
Clonality: polyclonal
Target(s): MTA2 (H-170)
Proper citation: Santa Cruz Biotechnology Cat# sc-28731, RRID:AB_2266707 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078998
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GMPR2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA000904, RRID:AB_1078998 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845302
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human BCAR3
Proper citation: Sigma-Aldrich Cat# HPA014858, RRID:AB_1845302 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1951761
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 39631 for not specified; status is not pursued
Host Organism: rabbit
Clonality: polyclonal
Target(s): RPN1
Proper citation: GeneTex Cat# GTX101888, RRID:AB_1951761 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10606343
Comments: manufacturer recommendations: Immunoprecipitation; Radioimmunoassay; Western Blot; WB, IPP, RIP
Host Organism: rabbit
Clonality: unknown
Target(s): AUH
Proper citation: MBL International Cat# RN037P, RRID:AB_10606343 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961994
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): ATP1B4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044128, RRID:AB_10961994 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847088
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): COL1A1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA011795, RRID:AB_1847088 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964357
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): SOX8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041640, RRID:AB_10964357 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963430
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): TSKS antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045729, RRID:AB_10963430 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962628
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): NOVA2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045607, RRID:AB_10962628 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857346
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): SNX16 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024731, RRID:AB_1857346 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335696
Comments: Used By NYUIHC-1311. Original Manufacturer: Dako. Now part of Agilent.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): Prealbumin isolated from human plasma.
Proper citation: Agilent Cat# A0002, RRID:AB_2335696 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079408
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): MPST antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA001240, RRID:AB_1079408 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855128
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): PDE7B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023967, RRID:AB_1855128 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_355295
Comments: Applications: Western Blot, Simple Western, Immunohistochemistry, Blockade of Receptor-ligand Interaction
Host Organism: Goat
Clonality: polyclonal
Target(s): Tie-2
Proper citation: R and D Systems Cat# AF313, RRID:AB_355295 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684646
Host Organism: rabbit
Clonality: unknown
Target(s): NDUFS2
Proper citation: Sigma-Aldrich Cat# HPA061953, RRID:AB_2684646 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.