Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 312 showing 6221 ~ 6240 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_2683433

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683433

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLR; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): NPB

Proper citation: Atlas Antibodies Cat# HPA057419, RRID:AB_2683433 Copy   


  • RRID:AB_2686718

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686718

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HEY2

Proper citation: Atlas Antibodies Cat# HPA074851, RRID:AB_2686718 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685850

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C16orf72

Proper citation: Atlas Antibodies Cat# HPA067492, RRID:AB_2685850 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680693

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRR16

Proper citation: Atlas Antibodies Cat# HPA049254, RRID:AB_2680693 Copy   


  • RRID:AB_1080416

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080416

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TTF2

Proper citation: Atlas Antibodies Cat# HPA005776, RRID:AB_1080416 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078132

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human ALG5

Proper citation: Sigma-Aldrich Cat# HPA007989, RRID:AB_1078132 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855105

Host Organism: rabbit
Clonality: polyclonal
Target(s): PDCD2L

Proper citation: Atlas Antibodies Cat# HPA019964, RRID:AB_1855105 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10963689

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): RNASE2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA044983, RRID:AB_10963689 Copy   


  • RRID:AB_10902053

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10902053

Comments: manufacturer recommendations: WB-Re,IHC-P; Western Blot; Immunohistochemistry - fixed; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): CXCL10 polyclonal antibody

Proper citation: Abnova Cat# PAB19527, RRID:AB_10902053 Copy   


  • RRID:AB_1841346

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1841346

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 11088-2F6 for not specified; status is not pursued
Host Organism: mouse
Clonality: monoclonal
Target(s): DPF2

Proper citation: Sigma-Aldrich Cat# WH0005977M1, RRID:AB_1841346 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859171

Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human ZNF295

Proper citation: Sigma-Aldrich Cat# HPA024655, RRID:AB_1859171 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10961286

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): TIGD6 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA044599, RRID:AB_10961286 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10961185

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): C9orf71 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045272, RRID:AB_10961185 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847532

Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): DDAH1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA006308, RRID:AB_1847532 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796110

Host Organism: rabbit
Clonality: polyclonal
Target(s): AL590708.2 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA014540, RRID:AB_10796110 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794645

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): SNRK antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA042163, RRID:AB_10794645 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794404

Comments: Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM151A antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA041035, RRID:AB_10794404 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845355

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH3GLB1

Proper citation: Atlas Antibodies Cat# HPA015608, RRID:AB_1845355 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681774

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRRC24

Proper citation: Atlas Antibodies Cat# HPA052250, RRID:AB_2681774 Copy   


Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_631276

Comments: Discontinued: 2016; Discontinued: 2016; Rabbit polyclonal affinity purified to amino acids 1-262 of c-Myc human origin. Antibody Target: MYC
Validation: ENCODE PROJECT validation information available
Host Organism: rabbit
Clonality: polyclonal
Target(s): MYC

Proper citation: Santa Cruz Biotechnology Cat# sc-764, RRID:AB_631276 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X