Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686720
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CEP72
Proper citation: Atlas Antibodies Cat# HPA074879, RRID:AB_2686720 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686856
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AMFR
Proper citation: Atlas Antibodies Cat# HPA077835, RRID:AB_2686856 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686701
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TACR1
Proper citation: Atlas Antibodies Cat# HPA074573, RRID:AB_2686701 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686769
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PREX2
Proper citation: Atlas Antibodies Cat# HPA075956, RRID:AB_2686769 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686698
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM173B
Proper citation: Atlas Antibodies Cat# HPA074513, RRID:AB_2686698 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686655
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HOXA7
Proper citation: Atlas Antibodies Cat# HPA074048, RRID:AB_2686655 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686770
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRRN4
Proper citation: Atlas Antibodies Cat# HPA075974, RRID:AB_2686770 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686688
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ADRA1B
Proper citation: Atlas Antibodies Cat# HPA074416, RRID:AB_2686688 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686694
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GJB3
Proper citation: Atlas Antibodies Cat# HPA074472, RRID:AB_2686694 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686741
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HEBP1
Proper citation: Atlas Antibodies Cat# HPA075277, RRID:AB_2686741 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686869
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LUZP6
Proper citation: Atlas Antibodies Cat# HPA077907, RRID:AB_2686869 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686721
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GKRRRGLHPFIPSLGPVFKSNLTATVVQSGECKRLGKVGEQPLGDENPSLWFGLR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): AC006449.2
Proper citation: Atlas Antibodies Cat# HPA074896, RRID:AB_2686721 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686804
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CHD3
Proper citation: Atlas Antibodies Cat# HPA076524, RRID:AB_2686804 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686660
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): YARS2
Proper citation: Atlas Antibodies Cat# HPA074097, RRID:AB_2686660 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686729
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GALNT9
Proper citation: Atlas Antibodies Cat# HPA075016, RRID:AB_2686729 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686875
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RASSF7
Proper citation: Atlas Antibodies Cat# HPA078015, RRID:AB_2686875 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686792
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARHGAP20
Proper citation: Atlas Antibodies Cat# HPA076303, RRID:AB_2686792 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686786
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KRT75
Proper citation: Atlas Antibodies Cat# HPA076201, RRID:AB_2686786 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686651
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TDP2
Proper citation: Atlas Antibodies Cat# HPA074011, RRID:AB_2686651 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686855
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRKAG1
Proper citation: Atlas Antibodies Cat# HPA077805, RRID:AB_2686855 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.