Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684328
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF556
Proper citation: Atlas Antibodies Cat# HPA060593, RRID:AB_2684328 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684341
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TAS2R39
Proper citation: Atlas Antibodies Cat# HPA060680, RRID:AB_2684341 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684354
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF34
Proper citation: Atlas Antibodies Cat# HPA060755, RRID:AB_2684354 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684165
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C19orf53
Proper citation: Atlas Antibodies Cat# HPA059928, RRID:AB_2684165 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2687580
Comments: Applications: W, IHC-P, IF-IC, F
Host Organism: rabbit
Clonality: monoclonal
Target(s): Cathepsin B
Proper citation: Cell Signaling Technology Cat# 31718, RRID:AB_2687580 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2687510
Comments: Discontinued; Applications: remove
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): FUT8
Proper citation: Proteintech Cat# 66118, RRID:AB_2687510 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2687616
Comments: Applications: W, IP, IHC-P, IF-IC
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): N-Cadherin
Proper citation: Cell Signaling Technology Cat# 13116, RRID:AB_2687616 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2687474
Comments: Applications: W, IP
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): xCT/SLC7A11
Proper citation: Cell Signaling Technology Cat# 12691, RRID:AB_2687474 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686917
Comments: Applications: IHC-P, IHC-Fr, WB in MDS.
Info: Used by Czech Centre for Phenogenomics
Host Organism: rabbit
Clonality: monoclonal
Target(s): CD4
Proper citation: Abcam Cat# ab183685, RRID:AB_2686917 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2687121
Comments: Applications: FC
Info: Used by Czech Centre for Phenogenomics
Host Organism: rat
Clonality: monoclonal
Target(s): CD317
Proper citation: BioLegend Cat# 127025, RRID:AB_2687121 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686885
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): NUDT9
Proper citation: Atlas Antibodies Cat# HPA078535, RRID:AB_2686885 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686871
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): KRT80
Proper citation: Atlas Antibodies Cat# HPA077918, RRID:AB_2686871 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686684
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CISD1
Proper citation: Atlas Antibodies Cat# HPA074383, RRID:AB_2686684 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686808
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLDN9
Proper citation: Atlas Antibodies Cat# HPA076613, RRID:AB_2686808 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686747
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC9A7
Proper citation: Atlas Antibodies Cat# HPA075385, RRID:AB_2686747 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686843
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLE; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): BLOC1S5
Proper citation: Atlas Antibodies Cat# HPA077525, RRID:AB_2686843 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686782
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH2B1
Proper citation: Atlas Antibodies Cat# HPA076175, RRID:AB_2686782 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686670
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLN6
Proper citation: Atlas Antibodies Cat# HPA074162, RRID:AB_2686670 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686851
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ADCY5
Proper citation: Atlas Antibodies Cat# HPA077682, RRID:AB_2686851 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686814
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RAPGEF5
Proper citation: Atlas Antibodies Cat# HPA076772, RRID:AB_2686814 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within NIF that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.