Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 308 showing 6141 ~ 6160 out of 56,320 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684328

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF556

Proper citation: Atlas Antibodies Cat# HPA060593, RRID:AB_2684328 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684341

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TAS2R39

Proper citation: Atlas Antibodies Cat# HPA060680, RRID:AB_2684341 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684354

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF34

Proper citation: Atlas Antibodies Cat# HPA060755, RRID:AB_2684354 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684165

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C19orf53

Proper citation: Atlas Antibodies Cat# HPA059928, RRID:AB_2684165 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2687580

Comments: Applications: W, IHC-P, IF-IC, F
Host Organism: rabbit
Clonality: monoclonal
Target(s): Cathepsin B

Proper citation: Cell Signaling Technology Cat# 31718, RRID:AB_2687580 Copy   


  • RRID:AB_2687510

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2687510

Comments: Discontinued; Applications: remove
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): FUT8

Proper citation: Proteintech Cat# 66118, RRID:AB_2687510 Copy   


  • RRID:AB_2687616

    This resource has 100+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2687616

Comments: Applications: W, IP, IHC-P, IF-IC
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): N-Cadherin

Proper citation: Cell Signaling Technology Cat# 13116, RRID:AB_2687616 Copy   


  • RRID:AB_2687474

    This resource has 50+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2687474

Comments: Applications: W, IP
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): xCT/SLC7A11

Proper citation: Cell Signaling Technology Cat# 12691, RRID:AB_2687474 Copy   


  • RRID:AB_2686917

    This resource has 100+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686917

Comments: Applications: IHC-P, IHC-Fr, WB in MDS.
Info: Used by Czech Centre for Phenogenomics
Host Organism: rabbit
Clonality: monoclonal
Target(s): CD4

Proper citation: Abcam Cat# ab183685, RRID:AB_2686917 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2687121

Comments: Applications: FC
Info: Used by Czech Centre for Phenogenomics
Host Organism: rat
Clonality: monoclonal
Target(s): CD317

Proper citation: BioLegend Cat# 127025, RRID:AB_2687121 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686885

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): NUDT9

Proper citation: Atlas Antibodies Cat# HPA078535, RRID:AB_2686885 Copy   


  • RRID:AB_2686871

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686871

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): KRT80

Proper citation: Atlas Antibodies Cat# HPA077918, RRID:AB_2686871 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686684

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CISD1

Proper citation: Atlas Antibodies Cat# HPA074383, RRID:AB_2686684 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686808

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLDN9

Proper citation: Atlas Antibodies Cat# HPA076613, RRID:AB_2686808 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686747

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC9A7

Proper citation: Atlas Antibodies Cat# HPA075385, RRID:AB_2686747 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686843

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLE; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): BLOC1S5

Proper citation: Atlas Antibodies Cat# HPA077525, RRID:AB_2686843 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686782

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH2B1

Proper citation: Atlas Antibodies Cat# HPA076175, RRID:AB_2686782 Copy   


  • RRID:AB_2686670

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686670

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLN6

Proper citation: Atlas Antibodies Cat# HPA074162, RRID:AB_2686670 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686851

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ADCY5

Proper citation: Atlas Antibodies Cat# HPA077682, RRID:AB_2686851 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686814

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RAPGEF5

Proper citation: Atlas Antibodies Cat# HPA076772, RRID:AB_2686814 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within NIF that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X