Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-CD164L2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA062915, RRID:AB_2684903 CD164L2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684903 Atlas Antibodies HPA062915 2025-08-19 05:52:48 0
Anti-HOXD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056900, RRID:AB_2683270 HOXD1 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683270 Atlas Antibodies HPA056900 2025-08-19 05:52:48 0
Anti-KIAA0895 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA061066, RRID:AB_2684423 KIAA0895 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684423 Atlas Antibodies HPA061066 2025-08-19 05:53:04 0
Anti-NSL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045761, RRID:AB_2679444 NSL1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679444 Atlas Antibodies HPA045761 2025-08-19 05:52:47 0
Anti-ZNF526 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056609, RRID:AB_2683189 ZNF526 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683189 Atlas Antibodies HPA056609 2025-08-19 05:52:48 0
Anti-LIX1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA058426, RRID:AB_2683715 LIX1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683715 Atlas Antibodies HPA058426 2025-08-19 05:53:04 0
Anti-TBL1Y polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA060073, RRID:AB_2684196 TBL1Y human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684196 Atlas Antibodies HPA060073 2025-08-19 05:52:48 0
Anti-WAS antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA002022, RRID:AB_1080581 WAS human Vendor recommendations: unknown rabbit AB_1080581 Sigma-Aldrich HPA002022 2025-08-19 05:53:01 0
Anti-HAVCR1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA007173, RRID:AB_1080282 HAVCR1 human polyclonal rabbit AB_1080282 Atlas Antibodies HPA007173 2025-08-19 05:53:06 0
ARID2 Antibody
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A302-230A, RRID:AB_1731041 ARID2 human Discontinued; Applications: IP (5-10 µg/mg lysate), IHC (1:500-1:2,000), WB (1:2,000-1:10,000) polyclonal rabbit AB_1731041 Thermo Fisher Scientific A302-230A 2025-08-19 05:52:53 1
Anti-ZNF184 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA064793, RRID:AB_2732722 ZNF184 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732722 Atlas Antibodies HPA064793 2025-08-19 05:52:53 0
Anti-KPNA7 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA031395, RRID:AB_10601584 KPNA7 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10601584 Sigma-Aldrich HPA031395 2025-08-19 05:53:05 0
Anti-SLC9B1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA065520, RRID:AB_2685502 SLC9B1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685502 Atlas Antibodies HPA065520 2025-08-19 05:53:09 0
Anti-PLEKHH1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA047707, RRID:AB_2680126 PLEKHH1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680126 Atlas Antibodies HPA047707 2025-08-19 05:53:15 0
Anti-TKT
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029480, RRID:AB_10599307 TKT rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10599307 Atlas Antibodies HPA029480 2025-08-19 05:53:14 0
SFRS6 (splicing factor, arginine/serine-rich 6) Antibody (against the middle region of SFRS6) (50ug)
 
Resource Report
Resource Website
Rating or validation data
Aviva Systems Biology Cat# ARP40632_P050, RRID:AB_1215920 SFRS6 (splicing factor arginine/serine-rich 6) (against the middle region of SFRS6) (50ug) chicken, rat, xenopusamphibian, porcine, pig, mouse, chickenbird, zebrafishfish, bovine, zebrafish, human manufacturer recommendations: IgG WB; ELISA; Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615122, AB_1215920. polyclonal rabbit AB_1215920 Aviva Systems Biology ARP40632_P050 2025-08-19 05:53:14 0
Anti-OSMR polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA017278, RRID:AB_1854818 OSMR human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRKSLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPE; Manufacturer approved use: IHC polyclonal rabbit AB_1854818 Atlas Antibodies HPA017278 2025-08-19 05:53:08 0
Anti-AKAP8 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA004776, RRID:AB_1078122 Human AKAP8 human Vendor recommendations: unknown rabbit AB_1078122 Sigma-Aldrich HPA004776 2025-08-19 05:53:18 0
Anti-URB1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA018334, RRID:AB_1856088 Human URB1 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1856088 Sigma-Aldrich HPA018334 2025-08-19 05:53:30 0
Anti-TRPC3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA037969, RRID:AB_10697090 TRPC3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI; Manufacturer approved use: IHC, WB polyclonal rabbit AB_10697090 Atlas Antibodies HPA037969 2025-08-19 05:53:27 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. Neuroscience Information Framework Resources

    Welcome to the NIF Resources search. From here you can search through a compilation of resources used by NIF and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that NIF has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on NIF then you can log in from here to get additional features in NIF such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into NIF you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.